Details for Capsella Locus Carubv10015544m

Position : scaf_3 ( 5`- 13479370 .. 13479753 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015544m

Protein [Map View]
MALTIYTCKECGSDLNLNPNDLFPRDFYFEAGNKKTLSFAAVDAGKFRFEKEDKIMPFFETLNYWGIQRKRTKINCNSCN
HLIGYIYDDGPPLTGGIGQYGFGPSQVVPRAPRYRFKTKAIQVSSQT*

DNA
ATGGCTTTAACGATCTACACTTGCAAAGAATGTGGATCAGATCTAAATCTGAACCCTAACGATTTGTTCCCACGGGATTT
CTACTTCGAAGCCGGAAACAAAAAAACACTCTCATTCGCCGCCGTCGACGCCGGAAAGTTCCGATTCGAAAAAGAAGACA
AGATTATGCCTTTCTTCGAAACCCTAAACTACTGGGGAATCCAACGGAAACGAACCAAGATCAATTGCAATAGTTGCAAC
CACCTCATCGGCTACATCTACGACGATGGTCCTCCTCTCACCGGCGGTATTGGTCAGTACGGATTCGGTCCTAGTCAAGT
CGTTCCTCGTGCTCCTCGGTATCGATTCAAAACCAAAGCGATTCAAGTCTCCTCTCAGACTTAG