Details for Capsella Locus Carubv10015543m

Position : scaf_3 ( 5`- 6177948 .. 6179943 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015543m

Protein [Map View]
MVLATNSDSEEHLHSTFASRYVRAVVPRFKMPDNSMPKDAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLIMDSVN
KNYVDMDEYPVTTELQNRCVNMIANLFHAPVGEDEAAIGCGTVGSSEAIMLAGLAFKRKWQQRRRAQGLPTDKPNIVTGA
NVQVCWEKFARYFEVELKEVKLNEDYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLAEKNAETGWETPI
HVDAASGGFIAPFLYPDLEWDFRLPWVKSINVSGHKYGLVYAGVGWIVWRTKDDLPEDLVFHINYLGADQPTFTLNFSKG
SSQIIAQYYQFIRLGFEGYKNIMENCMDNARRLREGIEMTGKFHILSKDIGVPLVAFSLKDSSKHTVFEIAESLRKFGWI
IPAYTMPADAQHIAVLRVVIREDFSRGLADRLITHIIQVLKEIEGLPSRIAHIAAAAAVSGDEVEVKTTKMSLEDITKYW
KRLVEHKRNIVC*

DNA
ATGGTGCTCGCAACCAACTCTGACTCCGAAGAGCATTTGCATTCCACTTTTGCTTCCAGATATGTCCGTGCTGTTGTTCC
CAGGTTTAAGATGCCGGACAATTCCATGCCGAAAGACGCTGCTTATCAAGTGATCAATGATGAGTTGATGCTTGATGGCA
ATCCCAGGCTTAACCTAGCTTCCTTTGTCACAACTTGGATGGAACCTGAGTGTGACAAACTCATCATGGATTCTGTGAAT
AAAAACTATGTTGACATGGATGAATATCCTGTCACTACTGAACTCCAGAACCGGTGTGTAAATATGATAGCTAACTTATT
CCATGCTCCCGTTGGAGAAGACGAGGCTGCTATTGGCTGTGGAACTGTTGGTTCATCAGAGGCTATAATGCTTGCCGGTT
TAGCTTTCAAAAGGAAATGGCAACAGAGGAGAAGAGCTCAGGGTCTACCTACTGATAAGCCTAACATTGTAACTGGAGCT
AATGTTCAGGTGTGCTGGGAGAAATTTGCAAGATACTTTGAGGTAGAGCTCAAAGAGGTGAAACTAAATGAAGACTATTA
CGTGATGGACCCAGCTAAAGCTGTAGAGATGGTGGATGAGAACACAATCTGTGTTGCAGCAATTCTAGGATCAACACTTA
CCGGAGAGTTTGAGGATGTGAAGCTATTGAACGATCTCTTAGCTGAGAAAAACGCAGAGACTGGTTGGGAAACTCCTATT
CACGTTGATGCAGCTAGTGGGGGATTCATTGCTCCTTTCCTCTACCCTGATCTTGAATGGGACTTTAGACTTCCATGGGT
GAAGAGCATCAATGTCAGTGGCCATAAGTATGGACTTGTGTATGCAGGAGTTGGTTGGATTGTCTGGAGAACAAAAGATG
ATTTGCCAGAGGACCTTGTCTTTCACATCAACTACTTAGGAGCAGATCAACCCACTTTCACTCTCAACTTCTCGAAAGGG
TCCAGTCAAATCATTGCTCAGTACTACCAGTTTATCCGACTAGGCTTTGAGGGATACAAGAACATAATGGAAAACTGCAT
GGACAACGCGAGGAGGCTGAGAGAAGGGATAGAGATGACAGGGAAGTTCCACATTCTCTCTAAAGATATCGGCGTGCCAC
TAGTGGCATTCTCTCTCAAAGACAGTAGCAAACATACGGTGTTTGAGATCGCAGAGTCTCTGAGAAAATTTGGGTGGATC
ATACCAGCTTACACCATGCCTGCAGATGCGCAACACATTGCTGTACTAAGAGTTGTGATCAGAGAAGACTTTAGCCGAGG
CCTCGCAGATAGACTCATCACACATATCATTCAAGTACTAAAAGAGATTGAAGGGCTTCCTAGCCGAATCGCGCATATAG
CTGCGGCAGCAGCTGTTAGTGGTGATGAAGTTGAAGTGAAGACTACAAAGATGTCATTGGAGGATATCACCAAGTATTGG
AAACGCCTTGTGGAACACAAGAGAAATATTGTCTGTTGA