Details for Capsella Locus Carubv10015535m

Position : scaf_3 ( 5`- 7180617 .. 7184351 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015535m

Protein [Map View]
MSISAQNPDISGDRQSGQDVRTQNVMACQAVSNIVKTSLGPVGLDKMLVDDIGDVTITNDGATILRMLEVEHPAAKVLVE
LAELQDREVGDGTTSVVIVAAELLKRANDLVRNKIHPTSIISGYRLAMRESCKYIEEKLVTKVEKLGKAPLINCAKTSMS
SKLISGDSDFFANLVVEAVLSVKMTNQRGEIKYPIKGINILKAHGQSARDSYLLNGYALNTGRAAQGMPLRVSPAKIACL
DFNLQKTKMQLGVQVVVNDPRELEKIRQREADMTKERIEKLLKAGANVILTTKGIDDMALKYFVEAGAIAVRRVRKEDMR
HVAKATGATLVTTFADMEGEETFDPAHLGSADEVVEERIADDDVILIKGTKTSSAVSLILRGANDYMLDEMERALHDSLC
IVKRTLESNTVVAGGGAVESALSVYLEHLATTLGSREQLAIAEFADALLIIPKVLAVNAAKDATELVAKLRAYHHTAQTK
ADKKHYSSMGLDLVNGTIRNNLEAGVIEPAMSKVKIIQFATEAAITILRIDDMIKLVKDESQGEE*

DNA
ATGTCGATCTCCGCCCAAAATCCGGATATTTCCGGCGATAGGCAATCCGGCCAAGATGTTCGTACTCAGAACGTGATGGC
TTGTCAAGCTGTTTCGAATATTGTTAAGACCTCACTTGGTCCCGTCGGACTCGACAAGATGTTGGTGGATGATATTGGTG
ATGTGACAATTACAAACGACGGTGCTACTATTCTTAGGATGTTAGAGGTCGAACACCCTGCTGCTAAGGTTCTTGTCGAG
TTAGCTGAACTCCAGGACAGAGAAGTTGGTGATGGGACTACGTCTGTTGTTATTGTAGCTGCGGAGTTGCTCAAGAGGGC
AAATGATTTGGTCAGGAATAAAATACATCCAACATCAATTATCAGTGGATACAGGCTAGCGATGAGAGAATCTTGCAAAT
ACATAGAAGAGAAGCTAGTGACGAAGGTTGAAAAGCTTGGAAAAGCTCCATTAATAAACTGTGCTAAAACCAGCATGTCC
TCCAAATTGATCTCTGGTGACAGTGACTTCTTTGCTAATTTGGTTGTGGAAGCTGTTCTGTCAGTAAAGATGACAAATCA
GCGGGGGGAGATAAAATACCCTATCAAGGGCATTAATATTCTGAAAGCTCACGGACAAAGTGCAAGAGACAGCTATTTGT
TAAATGGATATGCACTCAATACTGGTCGTGCTGCTCAAGGGATGCCATTACGAGTGTCTCCAGCAAAGATTGCTTGCCTT
GACTTCAATCTTCAAAAGACAAAAATGCAGTTAGGTGTCCAAGTTGTTGTTAACGACCCACGAGAACTTGAAAAGATCCG
TCAAAGAGAAGCTGACATGACAAAAGAGCGAATAGAGAAACTTCTTAAAGCTGGAGCAAATGTAATTCTAACCACGAAGG
GGATTGACGACATGGCACTTAAATATTTTGTAGAGGCAGGAGCTATTGCTGTTAGACGTGTGCGTAAAGAAGACATGCGC
CATGTTGCTAAGGCTACAGGAGCAACCCTGGTCACCACTTTTGCTGACATGGAGGGCGAAGAAACATTTGATCCAGCACA
CCTTGGATCTGCTGACGAAGTTGTGGAAGAGAGAATTGCAGATGATGATGTTATATTGATAAAAGGAACTAAGACAAGCA
GTGCGGTCTCATTGATCTTAAGAGGTGCAAATGACTACATGCTTGATGAGATGGAGAGAGCACTACACGACTCTTTATGT
ATTGTCAAGAGGACCCTCGAGTCTAATACGGTGGTTGCGGGTGGAGGCGCAGTTGAATCAGCATTGTCTGTGTATCTGGA
GCACCTTGCAACAACCTTGGGTTCTCGCGAACAATTAGCAATTGCTGAATTTGCTGATGCTCTATTGATTATACCAAAGG
TTCTTGCAGTAAACGCTGCTAAGGATGCAACCGAGTTGGTAGCTAAACTAAGAGCATACCACCACACTGCACAAACAAAG
GCTGATAAGAAGCACTATTCAAGCATGGGACTTGACCTCGTAAACGGAACCATCCGTAACAATTTGGAAGCAGGAGTTAT
CGAACCAGCTATGAGCAAAGTGAAAATTATCCAGTTTGCGACAGAGGCAGCCATAACAATTCTGCGAATTGACGACATGA
TCAAACTGGTGAAGGATGAGAGCCAAGGCGAAGAGTAA