Details for Capsella Locus Carubv10015529m

Position : scaf_3 ( 5`- 1277649 .. 1278344 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015529m

Protein [Map View]
MVRRREGLTLPILTSKLPEVNTTTKTTPTASHKPKQRLSKQLSMCETPRDVAWERRRRQMIIIQEKKLLHKGVSDNLSVQ
MKLTDEDLNELKGSIELGFGFNEEAGQKLCNTLPALDLYFAVNRQVSPLPSPSSSRSSSASASTFSNSIPCSPKKSDSDS
IKILRPGDDPQQMKQRLRHWAQAVACSVMQSY*

DNA
ATGGTGAGAAGAAGAGAAGGCCTTACATTGCCAATCTTGACATCGAAGCTTCCCGAAGTCAATACAACAACAAAGACAAC
ACCAACGGCCTCACATAAACCAAAACAACGGTTATCAAAACAACTTTCTATGTGTGAAACTCCACGAGACGTTGCTTGGG
AAAGAAGAAGACGTCAGATGATAATAATTCAAGAAAAAAAGCTACTTCATAAAGGCGTTTCAGACAATCTTAGTGTACAA
ATGAAGCTAACAGATGAGGACTTAAACGAGCTTAAAGGATCGATTGAGCTAGGTTTCGGTTTCAATGAAGAAGCAGGACA
AAAACTATGCAATACGTTACCAGCTCTCGATCTTTACTTTGCAGTGAACCGTCAGGTCTCACCTCTCCCTTCACCTAGCA
GCAGCCGTAGCAGTAGCGCATCTGCATCAACTTTCTCTAACAGTATACCTTGTAGTCCCAAAAAATCTGATTCAGATTCA
ATAAAGATCTTACGTCCAGGGGATGATCCTCAACAAATGAAGCAAAGATTGAGACACTGGGCACAAGCGGTTGCATGCTC
GGTTATGCAGTCTTATTGA