Details for Capsella Locus Carubv10015508m

Position : scaf_3 ( 5`- 7931966 .. 7935710 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015508m

Protein [Map View]
MSGSSMFKTKLCILFKKTGNCSRPNCSFAHGTAELRRPGESSFPGRRYNMDCDLRDRLGRQFSPERRPSLDRSGRRLQRF
NGHENARPFDNRREKDFRENHRFDERRDYAGGLKVGNRIEDRAEDGRNKFQGYNNVLEEQLKDVEMDVKMLTDDKLRLEA
SVERKAQEVDILTSRMQELENQLDREKEECRRITSSTKKFVKEYNRFLRAQDDLKRSEARLQKLGNQLSTYLAGSEGNNR
DGNVDIVSDEENNGRNLSIACDPQNELQNTSSMSRKKRYVDQYTTKETVEDGFIGRGEQERMEKEKEKKRPSRWNTVSSK
SYSEEESGAWNDEDTINKSSSKEDNWKRRRYSIGTSSTDKVISSMSMAARVFDDVAEFEEEIPEAAKSSPLISLPPPPPL
RDAHVQGEEADVNVDVMEQGKANDLDDSD*

DNA
ATGTCTGGGTCGAGTATGTTTAAGACGAAGCTTTGTATTCTGTTTAAGAAGACTGGTAACTGTTCGAGGCCGAATTGTTC
GTTTGCTCATGGTACTGCTGAGCTCCGTCGTCCTGGCGAGTCTTCTTTCCCTGGCAGACGTTACAATATGGATTGTGACT
TAAGAGATAGACTTGGTAGACAGTTTTCTCCAGAACGGAGACCTTCTTTAGACAGAAGTGGAAGGAGGCTACAAAGATTT
AATGGACATGAGAATGCTAGGCCATTTGACAACCGAAGAGAAAAAGACTTCAGGGAGAACCATAGATTTGATGAACGACG
TGATTATGCTGGAGGTTTGAAAGTTGGGAATAGGATTGAAGACAGGGCAGAAGATGGAAGAAACAAGTTTCAGGGTTACA
ATAATGTTCTGGAAGAGCAGTTAAAAGATGTAGAGATGGATGTTAAGATGCTCACTGATGACAAACTACGATTGGAGGCT
TCCGTTGAAAGGAAGGCACAGGAAGTAGACATTCTTACTTCTAGGATGCAGGAGCTTGAGAACCAGTTAGATAGAGAGAA
AGAGGAATGTAGGAGGATCACTTCAAGCACAAAGAAATTTGTGAAAGAATATAACCGCTTCTTGCGGGCACAAGATGATC
TAAAGAGGTCAGAAGCCCGTCTTCAGAAATTGGGAAACCAACTTAGCACGTATCTTGCTGGAAGTGAAGGAAATAATAGA
GATGGAAATGTGGATATTGTGAGCGATGAAGAGAACAACGGTCGGAATTTGAGTATCGCTTGTGATCCACAGAATGAGTT
GCAGAATACGTCTTCAATGTCTAGGAAAAAGCGTTATGTGGATCAATATACTACAAAAGAAACTGTTGAAGATGGCTTCA
TAGGAAGAGGTGAACAAGAGAGGATGGAGAAGGAGAAGGAGAAGAAGAGACCTTCTCGTTGGAATACGGTTTCTTCCAAA
TCATATTCTGAAGAAGAAAGTGGTGCGTGGAACGATGAAGACACAATTAACAAGTCCTCATCAAAGGAAGACAACTGGAA
GAGGAGAAGGTATTCTATTGGCACCTCATCTACTGATAAGGTAATATCGTCGATGAGCATGGCAGCTCGGGTATTTGATG
ATGTTGCAGAGTTTGAGGAAGAGATTCCGGAAGCAGCCAAAAGCTCTCCTCTCATATCTCTTCCTCCACCCCCACCTCTC
AGAGATGCCCATGTTCAGGGAGAAGAGGCGGATGTAAACGTTGATGTCATGGAACAGGGGAAAGCCAATGACCTTGATGA
CTCCGACTGA