Details for Capsella Locus Carubv10015503m

Position : scaf_3 ( 5`- 9588418 .. 9589422 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015503m

Protein [Map View]
MGWLVEALVASILLSLCFAITESAPESALITKLPGFNGSFPSKHYAGYVAIDKEGSKNLWYYFVESERNASIDPVVLWFN
GGPGCSSMDGFVYEHGPFNFEQTKTNKHLLHLNPYSWSKVSNIIYLDSPVGVGFSYSKNKSDYITNDTKTASDSYTFLLK
WFKMFPEFQSNPFYISGESYAGIYVPTLASKVVK

DNA
ATGGGTTGGTTAGTGGAAGCTCTTGTTGCTTCAATATTATTGTCTTTGTGTTTTGCAATAACAGAGTCAGCTCCAGAATC
TGCTCTCATTACCAAGCTTCCTGGTTTCAACGGCAGCTTTCCATCTAAACACTATGCCGGGTATGTGGCAATAGATAAAG
AGGGTAGTAAGAATCTATGGTATTACTTTGTGGAATCAGAGAGAAATGCTTCAATAGATCCAGTTGTGCTTTGGTTTAAT
GGTGGTCCAGGTTGTTCTAGTATGGATGGATTTGTCTATGAGCATGGTCCATTCAATTTCGAACAAACAAAGACAAACAA
ACATCTTCTACATCTAAATCCTTATAGTTGGTCTAAGGTGTCCAACATCATATATCTTGACTCTCCAGTTGGTGTGGGAT
TCTCTTACTCAAAGAACAAGTCTGATTACATAACTAATGATACGAAAACCGCGTCTGATTCTTACACATTCCTTCTCAAG
TGGTTTAAGATGTTTCCAGAGTTTCAGTCAAATCCGTTCTATATCTCAGGAGAATCATATGCTGGTATCTATGTGCCAAC
TCTTGCTTCTAAAGTTGTCAAA