Details for Capsella Locus Carubv10015501m

Position : scaf_3 ( 5`- 499845 .. 501009 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015501m

Protein [Map View]
MLKEESNESGTWARACDTCRSAACTVYCEADSAYLCNTCDARVHVANRLASRHERVRVCQSCESAPAAFFCKADAASLCT
ACDAEIHSANPLARRHQRVPILPLSANSCDSMAPSEADDADNDEDDREVASWLLPNPGKTSGNQNNGFLFGVEYLDLVDY
SSSLDNQFDDHQYSQYQQSFGGDGVVPLQVEESTNHLKQSQHNFQLGINYSGAHYNSSIKDLNYSASVSSMDISVVPEST
ASDITVHHPRTTRETIDQLSGPPTPMVQQLTPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKRIEI
EAEAEEIFSASLMSETGYGIVPSF*

DNA
ATGTTGAAAGAAGAGAGCAACGAGAGTGGCACTTGGGCACGAGCATGTGACACTTGTCGTTCAGCCGCCTGCACTGTCTA
CTGTGAAGCTGACTCTGCCTACTTGTGCAACACCTGTGATGCTCGTGTTCACGTTGCCAATCGTCTTGCTTCCCGCCATG
AACGTGTTCGTGTCTGCCAGTCATGCGAGTCTGCCCCTGCTGCCTTTTTCTGCAAAGCCGACGCTGCCTCTCTCTGCACA
GCCTGTGATGCTGAGATCCATTCCGCTAACCCTTTAGCTAGACGCCATCAACGAGTTCCCATCCTTCCCTTATCTGCAAA
CTCTTGCGATTCCATGGCCCCAAGCGAGGCTGATGATGCAGATAACGATGAGGATGATCGAGAGGTGGCTTCCTGGTTAC
TGCCTAATCCAGGGAAAACCAGCGGTAACCAGAACAATGGCTTCTTGTTTGGTGTTGAGTACCTTGACCTTGTGGATTAC
AGCTCCAGCTTGGACAACCAATTCGATGATCATCAGTACAGCCAATACCAGCAGAGCTTTGGAGGAGATGGAGTTGTGCC
ACTTCAAGTTGAAGAATCTACAAATCACCTGAAACAAAGCCAACACAACTTTCAGTTGGGCATCAACTATTCAGGAGCTC
ACTACAACTCCTCCATAAAGGACCTAAACTATAGCGCATCCGTTTCATCAATGGACATCAGTGTTGTGCCAGAGTCAACA
GCAAGTGACATAACAGTCCACCACCCAAGAACAACTAGAGAGACTATAGACCAACTATCTGGTCCTCCTACTCCGATGGT
GCAACAGCTTACTCCAATGGAAAGGGAGGCTAGGGTCCTGAGATACAGAGAGAAGAAGAAGACAAGGAAATTTGACAAGA
CAATAAGGTATGCTTCAAGAAAGGCATATGCAGAGATACGACCAAGAATCAAGGGCAGATTCGCAAAAAGGATAGAAATT
GAAGCTGAGGCTGAAGAAATCTTCTCAGCATCGCTAATGTCTGAGACTGGATATGGAATTGTTCCTTCCTTCTGA