Details for Capsella Locus Carubv10015495m

Position : scaf_3 ( 5`- 4092473 .. 4099761 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015495m

Protein [Map View]
MSSTFSPGSSRLLQLGVAGSASRLRSSSSKKPPEPLRRAVADCLSSSPPPANSHHGVIPSMAPSEALRNLRDYLSASATT
DLAYNMLLEHTVAERDRSPAVVTRCVALLKRYLLRYKPGEETLLQVDKFCVNLIAECDASLKQKSLPVLSAPAGDSPLPV
SSFASAALVKSLHYVRSLVALHIPRRSFQPAAFAGATLASRQLLPSLSSLLSKSFNSQLSPANAAESPQKKDAANLSVSN
LSNIQEINAMEDIEYISSDLLNWRWVGELQLSSASSESERPVNLQDMNNCNLLEVGAAGLLVGDMEAKMKGQHWKYFGTA
EMPYLEQLLQPASVTMITNSASARSHLRAITASKRTRAGPQQIWDDSTVNTFRPRARPLFQYRHYSEQQPLRLNTAEVGE
VIAAVCSEASSTPSNQMTVSPQLTSKTGKPSMDVAVSVLIKLVIDMYVLDARIAAPLTLSMLEEMLCSTKAACRIRVFDL
ILNLGVHAQLLEPMVSDSATTIEEEYAQETYMDNENRLLLQGTRTKDLPKMSSTSSAIENFESWILKILFEILLLLVQVE
EKEESVWASALSCLLYFICDRGKIRRNQLNGLDIRVIKALLGTSKRNSWSEVVHSKLICIMTNMFYRSPEPEGSTIANSS
ASNFLIDQVDLIGGVEYIFFEYSLATTREERRNLYSVLFDYVLHQINEACSVAGLSEYTDDEIQPLAVRLALADAPEAFY
ISVKLGVEGIGEILRRSIAAALSGFSNSERLNQLLANITEKFDTIIGSFTHLDKEFLHLKQITKSSKFLESIQDLRNDLS
VSVNLAWATLHSLLHSERTTYRQNGYIWLGDLLIAEISEESGGSIWLSIKDLQQKIAHCGTSDSLDTSDVPVSIHLLCGL
LKSRNSVIRWGFLFILERLLMRSKFLLDENETQRTTGGVATQDHKDKRLEKANAVIDIMSSALSLMAQINETDRINILKM
CDILFSQLCLKVLSTDDDAAPSSADRNSKFETSHRNSYKESMDEADTRPRYNNVSVSTCETASMAAMLLRGQAIVPMQLV
ARVPAALFYWPLIQLAGAATDNIALGVAVGSKGRGNIPGATSDIRATLLLLLIGKCTADTIAFQEVGGEEFFRELLDDTD
SRVAYYSSAFLLKRMMTEEPEKYQNMLQKLVFKAQQSNNEKLLENPYLQMCGILQLSNEL*

DNA
ATGTCTTCCACTTTTAGCCCCGGAAGCTCCCGCTTGCTGCAGCTGGGCGTTGCCGGCTCTGCCTCGCGCCTTAGATCTTC
TTCCTCCAAAAAGCCGCCTGAACCGCTGCGCCGGGCCGTGGCCGACTGCCTCTCATCCTCCCCTCCTCCGGCTAATTCTC
ACCATGGCGTTATCCCTTCCATGGCTCCGTCTGAAGCTCTCAGGAATCTCCGGGATTATCTATCAGCCTCTGCCACGACT
GACCTAGCCTACAACATGCTGTTAGAGCATACTGTAGCAGAGAGAGATCGCAGTCCAGCTGTGGTTACGAGGTGTGTGGC
ACTATTGAAACGGTATCTCTTAAGATATAAGCCTGGTGAAGAGACACTACTGCAGGTCGATAAATTTTGTGTGAATCTGA
TTGCTGAGTGCGATGCTAGCTTGAAGCAGAAATCATTGCCTGTTTTATCAGCACCAGCAGGGGATTCTCCTTTACCAGTG
TCCAGTTTTGCTTCTGCAGCTCTGGTGAAGTCATTGCATTATGTGCGTTCCCTTGTGGCTTTACATATCCCAAGGCGATC
CTTTCAACCTGCAGCATTTGCAGGAGCTACTCTTGCGTCAAGGCAGTTATTGCCATCTCTATCCTCTTTGTTGAGCAAAT
CATTCAATTCCCAATTAAGTCCTGCAAATGCCGCAGAATCTCCACAGAAAAAAGATGCTGCAAATCTGTCTGTTTCAAAT
TTGTCAAATATCCAAGAAATTAATGCTATGGAAGACATTGAATACATATCATCAGACTTGCTGAACTGGCGTTGGGTTGG
GGAGCTCCAGTTATCATCAGCTTCTTCTGAAAGCGAACGTCCCGTTAATCTCCAAGACATGAACAATTGTAATCTTCTGG
AAGTTGGTGCTGCCGGCCTGCTTGTAGGAGATATGGAAGCTAAAATGAAAGGCCAGCACTGGAAATATTTTGGTACCGCA
GAGATGCCTTACTTAGAACAACTGCTGCAGCCAGCTTCAGTCACGATGATAACAAACTCAGCCTCAGCTCGCTCCCACTT
AAGAGCAATAACAGCTTCCAAACGCACTAGAGCTGGCCCTCAGCAGATCTGGGATGATTCCACTGTAAACACATTTCGTC
CACGTGCCAGACCGCTTTTTCAGTATCGTCATTACAGTGAACAACAACCGCTGCGCCTAAATACAGCCGAGGTAGGTGAG
GTGATTGCCGCTGTTTGTTCTGAGGCATCATCCACCCCTTCAAATCAGATGACTGTATCACCCCAATTAACAAGCAAGAC
TGGAAAGCCGTCGATGGATGTGGCTGTGAGCGTCCTAATTAAGCTTGTTATCGACATGTATGTATTGGACGCTAGAATTG
CTGCTCCTCTTACTCTGTCCATGCTCGAGGAAATGTTATGTTCCACAAAAGCAGCTTGTAGGATTCGTGTCTTTGATTTA
ATTCTTAATTTAGGAGTTCATGCACAATTGTTAGAGCCAATGGTAAGTGATAGCGCGACAACCATTGAAGAAGAATACGC
CCAAGAAACATATATGGACAATGAAAATAGGCTATTACTGCAAGGGACAAGAACGAAAGACCTGCCGAAGATGTCAAGCA
CTTCTTCAGCTATTGAGAACTTTGAGTCTTGGATATTGAAAATCTTATTTGAAATACTTCTTCTCCTAGTTCAGGTTGAG
GAAAAGGAAGAATCCGTTTGGGCTTCTGCCCTCAGCTGCTTGCTCTATTTTATCTGTGATAGAGGCAAAATACGGAGAAA
CCAGCTAAATGGTCTTGACATAAGGGTTATCAAAGCTCTTCTGGGAACTAGCAAAAGGAATTCTTGGTCAGAGGTTGTTC
ATTCCAAGCTTATTTGTATTATGACGAATATGTTTTATCGATCTCCAGAACCAGAGGGCTCTACCATAGCAAATTCAAGT
GCCTCGAATTTTCTTATAGACCAGGTCGATCTGATTGGTGGTGTGGAGTACATTTTCTTTGAGTACTCTTTGGCAACCAC
TAGAGAAGAAAGAAGAAATCTCTACTCGGTTTTATTTGACTATGTTCTGCATCAAATTAATGAGGCATGTTCAGTGGCTG
GTCTTTCTGAGTACACTGACGATGAGATTCAACCTTTGGCTGTTCGGCTTGCTCTAGCTGATGCACCTGAAGCTTTCTAC
ATTTCTGTCAAGCTTGGTGTTGAAGGCATAGGGGAAATCCTCCGAAGATCAATTGCTGCAGCATTGTCTGGGTTCAGCAA
CAGTGAACGATTAAACCAGCTTTTGGCAAATATAACAGAAAAGTTTGACACAATAATAGGTTCATTTACTCACTTGGACA
AAGAGTTCCTGCATCTCAAACAGATTACCAAATCTTCGAAATTCTTGGAAAGCATTCAAGATTTAAGAAATGATTTAAGT
GTGTCAGTGAATCTAGCTTGGGCTACTTTGCACTCTCTTCTTCATTCAGAAAGGACCACATACCGTCAAAATGGATATAT
CTGGTTGGGAGATCTTCTGATTGCGGAAATTAGTGAAGAGAGTGGTGGAAGTATATGGCTAAGCATAAAAGATCTGCAAC
AAAAGATTGCCCATTGTGGTACCTCAGACTCTCTGGATACTTCCGATGTACCTGTTTCCATTCATCTTCTATGTGGACTC
TTGAAGTCAAGGAACAGTGTTATCAGATGGGGTTTCCTATTTATTCTGGAGAGGCTTCTTATGCGCTCCAAGTTTTTACT
AGATGAGAATGAGACTCAACGAACAACTGGTGGAGTTGCTACTCAGGATCATAAAGACAAACGCCTAGAGAAAGCAAATG
CTGTTATAGACATAATGAGCAGTGCTTTGTCTTTGATGGCACAAATAAATGAAACTGACCGTATTAATATCTTAAAGATG
TGTGACATTCTTTTCTCGCAATTGTGCTTGAAAGTTTTGTCTACTGACGATGATGCAGCTCCCAGTTCTGCTGACAGAAA
TAGCAAATTTGAAACTTCTCATCGTAACAGCTATAAAGAAAGTATGGATGAAGCTGACACCAGGCCTCGGTACAACAATG
TCTCTGTCTCAACGTGCGAGACGGCTTCAATGGCAGCGATGCTTCTTCGTGGACAGGCAATTGTTCCTATGCAACTGGTT
GCACGTGTGCCAGCGGCTTTGTTTTATTGGCCATTGATTCAACTAGCAGGGGCAGCAACTGACAACATTGCACTTGGTGT
CGCCGTTGGAAGCAAAGGAAGAGGAAATATTCCAGGGGCAACCTCTGATATCCGAGCCACCCTGCTATTACTTTTGATTG
GTAAATGCACCGCTGATACAATTGCTTTTCAAGAAGTTGGTGGAGAGGAGTTCTTTAGGGAACTCCTGGATGATACTGAC
TCAAGGGTGGCTTATTACTCTTCCGCATTTCTTCTGAAGAGGATGATGACGGAGGAACCAGAGAAATACCAAAACATGCT
TCAGAAGCTTGTCTTTAAGGCTCAGCAGAGCAATAATGAGAAACTGCTGGAGAATCCATACCTGCAGATGTGTGGTATAC
TTCAGTTATCAAACGAGCTTTGA