Details for Capsella Locus Carubv10015492m

Position : scaf_3 ( 5`- 1831465 .. 1832100 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015492m

Protein [Map View]
MEKSIKVGVSMSRVFSSFNFLTVINLSYTNLENEGAIALVNALKSSVPSLQVIEMAGNNITDEAAPAIAACLAAKRHLKK
CNLSQNDLEDEGCVEIVKSMEDLELEYVDMSYNKLTREGALSLAPVVVKKESFKMLNIYGNMISARGIDEVKEIFKNCPN
LLGPSDENDSLGEEDEDYEESEDFEDEFVSVFIFY*

DNA
ATGGAAAAGAGCATAAAAGTTGGAGTTTCTATGAGTAGAGTATTTTCAAGCTTCAATTTCTTGACAGTAATTAACCTAAG
TTATACCAATCTAGAGAATGAAGGTGCTATAGCTCTAGTAAACGCTCTCAAGAGCTCTGTTCCATCTCTTCAAGTTATAG
AAATGGCTGGAAACAACATAACCGATGAGGCGGCTCCTGCTATTGCCGCTTGTTTGGCAGCCAAGCGACATCTGAAAAAG
TGTAACTTGTCCCAGAATGATCTCGAAGACGAGGGATGTGTTGAAATTGTAAAGAGTATGGAAGATTTGGAGTTAGAATA
TGTTGATATGAGCTACAATAAACTGACAAGAGAAGGAGCATTGAGTTTGGCTCCTGTTGTTGTCAAGAAAGAAAGTTTCA
AGATGTTGAACATTTATGGGAATATGATCTCTGCTAGAGGCATTGATGAAGTCAAAGAGATATTCAAGAATTGTCCCAAT
CTACTTGGACCTTCGGATGAGAATGACTCTCTTGGAGAAGAAGATGAGGATTATGAAGAGAGCGAAGATTTTGAAGATGA
ATTCGTGAGTGTATTTATCTTTTACTAG