Details for Capsella Locus Carubv10015490m

Position : scaf_3 ( 5`- 607745 .. 608795 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015490m

Protein [Map View]
MAFVTTAEVCDANQEMIRSGQLRALQPVFQIYGRRQIFSGPVVTVKVFEDNGLIRHFLEEKGNGRVLVVDGGGSLRCAIL
GGNPVVQAQNNGWAGIIVNGCIRDVDEINGCDIGVRALASHPIKASKKGLGEQRVPLNIAGTRICDGEWLYADTDGILVS
QIELSV*

DNA
ATGGCGTTTGTGACCACTGCGGAAGTTTGTGACGCGAATCAAGAGATGATTCGTAGTGGCCAGCTCCGAGCTCTGCAACC
CGTCTTCCAGATTTACGGTCGTCGTCAAATATTCTCAGGTCCAGTAGTTACTGTCAAAGTTTTTGAAGACAATGGCTTAA
TTCGTCACTTCCTCGAAGAGAAAGGCAATGGAAGAGTTCTTGTGGTGGATGGTGGAGGGAGTTTACGATGTGCGATACTT
GGAGGAAACCCAGTTGTACAAGCTCAGAACAACGGATGGGCTGGGATCATTGTGAACGGTTGCATCAGAGACGTTGATGA
GATCAATGGCTGTGACATTGGAGTGAGAGCTTTAGCTTCTCATCCAATAAAGGCGAGTAAGAAAGGACTTGGTGAACAAA
GAGTCCCTTTGAACATAGCAGGAACTCGGATTTGTGATGGTGAATGGCTTTATGCAGATACTGATGGTATCCTGGTTTCT
CAGATCGAATTATCTGTTTAA