Details for Capsella Locus Carubv10015469m

Position : scaf_3 ( 5`- 3440740 .. 3441618 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015469m

Protein [Map View]
MTRSQTYPLDKMPLEMKEEICMKLEVECITKLIALSKSWSSIVRNKIFTNLYLNQSLARPRILISLIGVQDMQHFFLSCS
QEDPSSDHRTVSCNPPRQGNWYNFSPPVRGLMSCMCDNNKVMIGNPSTRQLITLPRVKTVRKDILHFFGYDPVKGEYKVL
CMTVSRNPTRSRSGEAVTEEHQVFTLGAKRKKWRKIECEHLHYAHPRTQGICSNGVVYYLAWVENVRFLICFDVGSEKFS
VMELPGDVEGLSNYGEKIAVTKMIIDGNIDLWVLEDASKQKWSKTTIVTSSWI

DNA
ATGACAAGGTCCCAGACCTACCCGTTGGACAAGATGCCTCTCGAAATGAAAGAGGAGATTTGCATGAAACTGGAGGTCGA
ATGCATCACGAAGCTCATTGCCCTTTCTAAATCCTGGTCATCGATAGTCCGTAACAAAATTTTCACCAACTTGTACCTGA
ATCAATCTTTGGCTCGGCCACGCATTCTGATCTCATTAATCGGCGTTCAAGACATGCAGCACTTCTTCCTCTCTTGCTCT
CAGGAGGATCCATCTTCTGATCATCGCACTGTCAGTTGTAACCCTCCGAGGCAGGGTAATTGGTACAACTTTTCTCCACC
TGTCCGCGGCTTGATGAGCTGTATGTGTGATAATAATAAAGTGATGATTGGGAATCCTAGTACTCGTCAGCTTATTACTT
TACCGAGAGTCAAAACTGTGAGGAAAGACATACTCCACTTCTTTGGATATGATCCTGTAAAGGGTGAATACAAAGTGTTG
TGCATGACGGTGTCACGTAATCCTACACGTAGTAGATCAGGAGAGGCTGTGACGGAGGAGCATCAAGTGTTCACTCTAGG
AGCTAAGAGAAAGAAATGGAGGAAGATCGAATGTGAGCATCTCCATTATGCTCATCCTAGAACTCAAGGGATATGCAGCA
ATGGGGTTGTGTATTATCTGGCATGGGTCGAAAATGTTCGTTTTCTGATATGCTTTGATGTGGGGTCTGAAAAGTTTAGT
GTCATGGAGTTACCCGGGGACGTCGAAGGTCTGTCCAACTACGGCGAAAAGATAGCTGTGACGAAAATGATCATCGACGG
TAATATCGACTTGTGGGTTCTTGAAGATGCCAGCAAACAAAAATGGTCAAAAACTACAATCGTGACTTCTTCTTGGATA