Details for Capsella Locus Carubv10015459m

Position : scaf_3 ( 5`- 1369451 .. 1369856 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015459m

Protein [Map View]
MKRFLVAFLLVLVFFCAEMRKGDGGKIPVVPVPTGKWCGYALPMKPCNDDVCAKRCIADNTHGWLMATGMCTSIPSLKDC
YCVHQCP*

DNA
ATGAAGAGATTTTTGGTCGCGTTTCTTCTTGTGCTCGTCTTCTTCTGTGCCGAGATGAGAAAAGGGGATGGAGGGAAGAT
ACCAGTAGTACCAGTGCCAACGGGGAAATGGTGTGGATACGCATTACCGATGAAACCATGCAACGACGACGTCTGCGCTA
AACGGTGTATTGCGGATAACACGCATGGCTGGCTCATGGCTACCGGCATGTGCACTTCTATCCCTAGCTTAAAGGATTGT
TACTGTGTCCATCAGTGTCCTTGA