Details for Capsella Locus Carubv10015456m

Position : scaf_3 ( 5`- 2670192 .. 2671205 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015456m

Protein [Map View]
MAAMAKLHLSAKADQSSVRLPRVIKLFRDPTTKVSFPRNGSVSSLHTNLSSPKLAIPCAGGGGGNIGNHGGGSGSGGGGG
YGGSSGEAEENGSSSWGPIGIFIQGWRSRVAADSQFPFKVLMEMLVGVSANVLGDMASRPNFGLNELDFVFSTLVVGSIL
NFTLMYLLAPSAASPGSSNLLPGIFRSCPSSHMFEQGSFTVMNRFGTLVYKGMVFATVGLAAGLVGTAISNGLVKMRKKM
DPSFETPNKPPPTLLNSLTWATHMGVSANVRYQTLNGAEFLLEKSLPPLVFKTGVIALRVVNNVLGGMSFVVLARMTGSQ
SVGDEERTEMSEKEKDD*

DNA
ATGGCGGCTATGGCGAAGCTTCATTTATCAGCGAAAGCGGATCAGAGCAGTGTGCGATTGCCGAGAGTGATCAAACTCTT
CCGCGATCCAACCACGAAAGTCTCGTTTCCACGAAATGGATCGGTTTCTTCACTCCACACCAACTTATCTTCTCCAAAAC
TCGCGATTCCTTGCGCCGGAGGTGGTGGTGGGAACATTGGTAATCACGGCGGTGGAAGCGGAAGCGGGGGAGGAGGTGGT
TACGGAGGTTCAAGCGGTGAAGCAGAAGAAAATGGATCGTCTTCATGGGGACCAATAGGGATATTCATACAAGGATGGAG
ATCACGAGTTGCAGCTGATTCTCAATTCCCTTTCAAGGTACTAATGGAAATGCTGGTCGGAGTTAGCGCCAATGTACTTG
GTGACATGGCTTCACGCCCTAATTTTGGATTGAACGAGCTCGATTTCGTCTTCTCTACACTCGTTGTAGGTTCGATTCTC
AATTTCACACTCATGTACCTCTTAGCTCCCTCTGCAGCATCTCCTGGCTCCTCCAATTTACTCCCTGGGATCTTTAGAAG
CTGCCCTTCAAGTCATATGTTTGAACAGGGTAGCTTCACCGTTATGAACCGTTTTGGGACTCTTGTATACAAAGGAATGG
TTTTTGCGACCGTTGGATTAGCTGCAGGTCTTGTTGGAACTGCCATCTCTAATGGGTTGGTTAAGATGAGGAAGAAGATG
GACCCGAGCTTCGAAACGCCAAACAAGCCTCCCCCTACGCTGCTGAATTCCTTAACATGGGCAACGCATATGGGAGTGAG
CGCCAATGTGAGGTACCAAACGTTGAATGGGGCAGAGTTCTTGCTGGAAAAGTCGTTGCCGCCATTGGTGTTTAAGACAG
GTGTGATAGCTTTGAGGGTTGTGAACAATGTTTTGGGAGGAATGTCGTTTGTTGTATTGGCGAGGATGACTGGATCACAG
TCAGTGGGGGATGAGGAGAGGACAGAGATGTCAGAGAAGGAGAAGGATGACTGA