Details for Capsella Locus Carubv10015448m

Position : scaf_3 ( 5`- 2827007 .. 2829022 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015448m

Protein [Map View]
MNPATDPVSVAAAAAALAPPPQPPQPHRLSTSCDRHPEERFTGFCPSCLCERLSVLDQTNNGASSSSRKPPTISAAALKA
LFKPSGGNSSGNGRVKPGFFPELRRTKSFSASKNNEGFSGVFEPQRRSCDVRTRSSLWNLFSQDEQRNLPNTVSGGEIEV
EPRKSSVAEPVLEVNDEGEAESDDEVEEEEEEEEEDYVEAGDFEILNDSGELSRGKSDEIVEEIQEIAETVKPEKTISEE
ELKPIKDYIDLDSQTKKPSVRRSFWSAASVFSKKLQKWRQNQKMKKRRNAGDHRPGSARLPVEKPIGRQLRDTQSEIADY
GFGRRSCDTDPRFSLDAGRFSLDAGRFSVDIGRISVDDPRYSFDEPRASWDGSLIGRTAFPPAARAPPPPSMLSVVEDAA
PPVHRHVTRADMQFPVEEPPPPAPVVNQSNGVSDPVIIPGGSIQTRDYYTDSSSRRRKSLDRSSSMRKTAAAVVADMDEP
KLSVSSAISIDAYSGSMRDHNNNYAVETTDNGFFREPAMMVGERKVNSNDNNNKKSRRWGKWSILGLIYRKSVNKYEEEE
EEEDRYRRLNGGMVERSLSESWPELRNGGGGPRMVRSNSNVSWRSSGGGSQRKVHGLDRNKSSRYSPKNGENGMLKFYLP
TMKGSRRMTGAGGGWANSNGHSIARSVMRLY*

DNA
ATGAATCCAGCTACTGACCCTGTCTCCGTCGCCGCAGCAGCAGCAGCTTTAGCCCCGCCTCCCCAACCTCCTCAGCCTCA
CCGCCTCTCTACCTCTTGCGACCGTCACCCCGAAGAGCGTTTCACCGGTTTCTGCCCTTCCTGTCTCTGTGAACGTCTCT
CTGTCTTAGATCAGACCAACAATGGCGCTTCCTCTTCTTCTCGCAAACCTCCCACCATCTCCGCTGCCGCTCTCAAGGCT
CTTTTCAAGCCTTCCGGAGGTAACAGCAGCGGAAACGGCCGCGTTAAACCCGGATTCTTCCCTGAGCTCCGTCGCACTAA
ATCTTTCTCGGCGTCTAAGAACAACGAAGGGTTCTCAGGCGTCTTTGAGCCACAACGTAGGTCTTGCGACGTCAGAACTC
GTAGCTCTCTTTGGAACTTGTTTAGCCAAGATGAGCAACGAAACCTTCCCAACACTGTCTCCGGCGGTGAGATTGAAGTC
GAGCCGAGAAAATCTAGCGTCGCGGAGCCTGTTTTAGAGGTGAACGATGAAGGAGAAGCTGAAAGTGACGACGAAGTCGA
AGAGGAAGAGGAAGAGGAAGAGGAGGACTACGTTGAAGCTGGCGACTTTGAGATCCTTAATGATTCCGGCGAACTAAGCA
GGGGAAAAAGCGACGAAATTGTTGAAGAGATACAAGAGATTGCGGAAACGGTGAAACCGGAAAAGACTATTAGCGAAGAG
GAGTTGAAGCCGATTAAGGATTACATAGATCTTGATTCTCAAACCAAGAAGCCATCTGTGCGACGGAGTTTTTGGTCGGC
GGCCTCTGTTTTTAGCAAGAAGCTTCAAAAATGGAGGCAGAATCAAAAGATGAAGAAACGCCGTAACGCCGGCGACCATC
GCCCCGGATCAGCTAGATTACCGGTGGAGAAACCGATTGGGAGACAGCTCCGGGATACTCAATCAGAGATTGCTGATTAC
GGATTCGGCCGGAGATCCTGCGACACAGATCCTAGATTCTCGCTCGACGCCGGAAGATTCTCTCTTGACGCCGGGAGATT
CTCTGTTGACATTGGTAGGATCTCGGTTGATGACCCTCGTTACTCGTTCGACGAGCCGAGAGCTTCTTGGGACGGGTCCC
TGATCGGACGGACAGCGTTTCCTCCCGCTGCGAGAGCTCCTCCTCCGCCGTCGATGCTTTCTGTGGTGGAGGATGCGGCG
CCGCCGGTGCACCGTCACGTAACCCGAGCAGATATGCAGTTCCCGGTGGAAGAACCACCACCGCCGGCACCGGTGGTTAA
TCAATCTAACGGTGTGTCTGACCCGGTTATTATCCCGGGTGGGTCAATCCAAACCCGAGACTACTACACTGACTCATCGT
CACGGAGGCGGAAGAGTCTGGACAGGTCTAGCTCCATGAGGAAAACGGCTGCAGCGGTTGTGGCTGATATGGACGAGCCA
AAGCTTTCAGTGTCTTCGGCTATATCAATAGATGCTTACTCAGGATCAATGAGAGATCATAACAACAATTATGCCGTGGA
GACCACGGATAACGGGTTTTTCCGGGAACCGGCAATGATGGTCGGCGAGAGGAAAGTGAATAGTAACGATAATAATAACA
AGAAGTCGAGGCGGTGGGGGAAATGGAGCATCTTAGGACTTATTTACAGGAAGAGTGTGAACAAGTACGAGGAAGAGGAG
GAGGAAGAGGATAGGTATAGGAGACTAAACGGGGGAATGGTGGAGAGATCGTTATCGGAGTCATGGCCGGAGCTGAGGAA
TGGAGGAGGAGGGCCGAGGATGGTGAGGAGTAATAGCAATGTGAGCTGGAGAAGTAGCGGTGGTGGATCACAGAGGAAAG
TACACGGATTGGATAGGAATAAGAGTTCAAGGTACTCCCCTAAGAATGGGGAAAACGGAATGTTGAAGTTTTACTTGCCA
ACTATGAAAGGTAGCCGGAGAATGACCGGTGCAGGAGGCGGGTGGGCCAATAGTAACGGGCATTCAATAGCGAGGAGTGT
AATGAGGCTGTATTGA