Details for Capsella Locus Carubv10015441m

Position : scaf_3 ( 5`- 3096109 .. 3096387 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015441m

Protein [Map View]
MGKVSWLLNLLNHANKQESVETLDKNGVLMASSSGFKMPLHYPRYTKEDYKEMEEWRLDLLLSDYGLLAFHDNTLHEKRA
FAMETFLWLHHP*

DNA
ATGGGAAAGGTGAGTTGGCTTCTTAACTTACTTAATCATGCCAACAAGCAAGAAAGTGTTGAGACTCTCGACAAAAACGG
TGTCTTAATGGCCTCAAGCAGTGGATTCAAGATGCCTTTGCATTACCCAAGATACACAAAGGAGGACTACAAGGAGATGG
AAGAGTGGAGATTGGATCTGCTTCTTTCGGACTACGGACTTCTTGCCTTCCATGACAATACCCTCCATGAGAAGCGAGCT
TTTGCTATGGAAACTTTTTTGTGGCTTCATCACCCGTAA