Details for Capsella Locus Carubv10015437m

Position : scaf_3 ( 5`- 5020654 .. 5021880 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015437m

Protein [Map View]
MILRRLVLSAASTSNPRISQSLSSSAILLLSSLSSDRYASSPQRYSGEDKLARLKHKDWLAPNEVLKIFENVKEPSFLIP
AYQHYSKRKDYQPTEPLYALLINKFGQAKMFDEIEEVMRIVKLEKRCRFSEEFFYNLMRIYGNLGGRINRAIEILFSMPD
FGCWPSPKSFNFILNLLVSAKLFDEIHKIFVSAPKLGVEIDACCMNILIKGLCESGNLEAALQLLDEFPKQKSRPNVMTF
SPLIRGFCNKGKFAEAFELLERMEKERIEPDTITFNILISGLRKKGRVEEGIQLLERMKLKGCQPNPGTYQEVLYGLLDK
KRNLEAKEMMSQMISWGMRPSFLSYKKMVLGLCETKSVAELDWVLRQMVNHGFVPKTGMWWKVGNCVISKTNDSQEILNL
VTCQDNPE*

DNA
ATGATTCTTCGGAGGCTTGTTCTGTCTGCAGCATCGACTTCAAATCCCAGAATAAGCCAATCACTTTCATCTTCTGCTAT
TCTTCTTCTCTCATCTTTATCTTCAGATAGATATGCGTCGTCGCCGCAACGATACTCTGGTGAAGATAAACTCGCCAGGC
TAAAGCACAAGGACTGGCTAGCCCCAAACGAGGTTTTGAAGATCTTTGAAAATGTCAAAGAGCCGAGCTTTCTGATACCG
GCTTACCAGCATTACTCTAAACGTAAAGATTATCAACCAACGGAACCTCTCTACGCCCTTCTGATCAACAAGTTCGGACA
AGCTAAGATGTTCGACGAAATAGAAGAAGTAATGAGAATTGTAAAGCTTGAGAAAAGATGTCGTTTCTCGGAGGAGTTCT
TTTACAATCTGATGAGAATTTACGGGAATTTAGGCGGTAGAATCAACCGAGCGATCGAGATTTTGTTCAGTATGCCGGAT
TTTGGATGCTGGCCAAGTCCTAAAAGTTTCAACTTCATTTTGAATCTACTTGTTTCCGCGAAGCTGTTCGATGAGATTCA
TAAGATATTCGTGAGTGCCCCTAAGCTAGGTGTTGAAATAGATGCTTGTTGTATGAATATACTCATCAAAGGACTGTGTG
AGAGTGGGAACTTGGAAGCTGCACTCCAACTGCTCGACGAATTTCCTAAACAAAAATCACGGCCTAATGTGATGACGTTT
TCTCCTCTAATCCGTGGTTTCTGCAACAAGGGAAAGTTCGCAGAAGCTTTTGAGTTGTTGGAGAGGATGGAGAAGGAGCG
AATCGAACCAGACACGATCACGTTTAACATTTTGATTTCAGGGCTTAGGAAGAAAGGCAGGGTTGAAGAAGGGATTCAAC
TTTTGGAGAGAATGAAGCTAAAGGGGTGTCAACCAAACCCTGGGACTTATCAGGAGGTACTCTATGGTCTCTTGGATAAA
AAGAGGAACTTGGAAGCTAAAGAGATGATGAGTCAGATGATTTCATGGGGTATGAGACCCAGTTTTCTGTCGTACAAAAA
GATGGTTCTGGGGCTCTGTGAAACGAAGTCAGTTGCGGAATTGGACTGGGTTTTGAGGCAAATGGTGAATCATGGTTTTG
TTCCAAAAACAGGGATGTGGTGGAAAGTTGGTAATTGTGTAATTTCGAAGACTAATGACTCGCAAGAAATTTTGAATCTC
GTTACTTGCCAAGACAATCCTGAATAA