Details for Capsella Locus Carubv10015436m

Position : scaf_3 ( 5`- 609496 .. 611999 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015436m

Protein [Map View]
MEIILSAFVRRVLVVCGEVHGNNCGPLIKINTERWNASVITTCAQPLPMSASSLFNLPLMRLRSLALSSSSSFQFSHRPL
SSIRFVLSPGKLPNFRAFSATAMTDTKDAGMDAVQRRLMFEDECILVDETDRVVGHDSKYNCHLMENIEAKNLLHRAFSV
FLFNSNYELLLQQRSNTKVTFPLVWTNTCCSHPLYRESELIQENALGVRNAAQRKLLDELGIVAEDVPVEEFTTLGRMLY
KAPSDGKWGEHELDYLLFIVRDVKVQPNPDEVAEIKYVSREELKELVKKADAGEEGLKLSPWFRLVVDNFLMKWWDHVEK
GTLDEAIDMKTIHKL*

DNA
ATGGAAATAATCTTATCTGCTTTTGTTAGAAGGGTTTTGGTCGTATGCGGAGAGGTTCATGGTAATAACTGTGGACCTTT
GATAAAAATAAACACAGAAAGGTGGAACGCATCAGTCATCACCACATGCGCACAACCACTACCAATGTCTGCTTCTTCTT
TATTTAATCTCCCGTTGATGCGCCTCAGATCTCTCGCTCTTTCGTCGTCTTCTTCTTTCCAGTTTTCACATCGTCCTCTA
TCATCGATCCGATTCGTTCTTTCACCGGGAAAGTTACCAAATTTTCGTGCTTTCTCCGCTACCGCTATGACAGATACTAA
GGATGCTGGGATGGATGCTGTTCAGAGACGTCTCATGTTCGAGGATGAATGCATTCTTGTTGATGAAACTGATCGTGTCG
TGGGGCATGATAGCAAATATAACTGTCATCTGATGGAAAATATTGAAGCTAAAAATTTGCTTCACAGGGCTTTTAGTGTA
TTTTTATTCAACTCGAACTATGAGTTGCTTCTCCAGCAAAGGTCAAACACAAAGGTTACATTCCCTCTCGTATGGACAAA
CACTTGTTGCAGCCATCCTCTTTACCGTGAATCGGAGCTTATCCAGGAAAATGCACTAGGTGTGAGGAATGCTGCACAGA
GAAAGCTTCTCGATGAGCTTGGTATTGTAGCTGAAGATGTACCAGTTGAGGAGTTCACTACCTTGGGACGTATGCTTTAC
AAGGCTCCTTCGGATGGCAAATGGGGAGAGCATGAACTTGATTACTTGCTCTTCATCGTGCGGGATGTGAAGGTTCAACC
AAATCCAGACGAAGTAGCTGAAATCAAGTATGTGAGCCGGGAAGAGCTGAAGGAGCTGGTGAAAAAAGCAGATGCAGGTG
AGGAAGGTTTGAAACTGTCTCCATGGTTCAGATTGGTGGTGGACAATTTCTTGATGAAGTGGTGGGATCATGTTGAGAAA
GGAACTTTGGATGAAGCAATAGACATGAAGACCATCCACAAACTCTGA