Details for Capsella Locus Carubv10015429m

Position : scaf_3 ( 5`- 13459998 .. 13460210 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015429m

Protein [Map View]
MASNEAGRPLPKFGEWDVNDPATADGFTVIFSKAGEDKKTGQSSTKTNSQRRKQDGDKPTAKKWLCFTFA*

DNA
ATGGCATCAAACGAAGCTGGAAGGCCATTGCCAAAATTCGGAGAATGGGATGTGAATGATCCTGCGACGGCTGATGGATT
CACGGTGATATTTAGCAAAGCCGGTGAAGATAAAAAGACCGGACAGAGTTCGACGAAGACGAATTCACAAAGAAGAAAAC
AAGATGGTGATAAACCAACGGCCAAGAAATGGCTCTGTTTCACTTTTGCTTGA