Details for Capsella Locus Carubv10015419m

Position : scaf_3 ( 5`- 6150498 .. 6151012 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015419m

Protein [Map View]
MLISEGTEHIVGDSSGWELFTNYSNWTQGREFHVGDVLVFNYKSDQHNVMQVNSTAYTNCGTDNYTSLFTKGNDSIIISE
VGKLWFICGVDDHCENGQKLSINVAP*

DNA
ATGCTAATATCTGAAGGAACAGAACATATAGTTGGCGACAGCAGTGGGTGGGAGCTCTTTACAAACTATAGCAACTGGAC
ACAGGGAAGAGAGTTTCATGTAGGCGATGTCTTAGTATTCAACTACAAAAGTGACCAGCATAATGTTATGCAAGTTAACT
CTACAGCATACACAAATTGTGGAACAGACAACTACACATCCCTCTTCACCAAAGGCAACGACTCAATTATCATATCAGAA
GTTGGAAAGCTATGGTTCATCTGCGGAGTGGATGATCACTGTGAAAATGGCCAGAAGCTAAGCATTAATGTAGCTCCTTG
A