Details for Capsella Locus Carubv10015418m

Position : scaf_3 ( 5`- 6566582 .. 6566887 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015418m

Protein [Map View]
MFTTRPPQQHYWRRTLLSISPPQSFLLLILLCFFFIHHCHASRFSSSSVFYRNPNNDHNNNNNRMRMRGHFLGFFPRHLP
VPASAPSRKHNDIGIQALLSP*

DNA
ATGTTTACTACGCGTCCTCCACAACAACATTATTGGAGAAGAACATTATTATCAATAAGCCCACCACAGTCTTTTCTTCT
TCTGATACTACTCTGCTTCTTCTTCATCCACCACTGCCACGCCTCGAGATTCTCGTCATCAAGCGTTTTCTACAGAAACC
CTAATAATGATCACAACAACAACAACAACAGGATGAGGATGAGAGGCCATTTCTTAGGATTCTTTCCAAGACACTTGCCT
GTTCCAGCTTCTGCTCCTTCACGAAAGCACAACGACATTGGTATTCAAGCACTTTTGTCTCCATGA