Details for Capsella Locus Carubv10015417m

Position : scaf_3 ( 5`- 962652 .. 963691 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015417m

Protein [Map View]
MADQQQRSHNTSDSRRKSLAGKRTSQQTPTTSSLSSGGGAMAATTTTGTGTASPCGACKFLRRKCVSGCIFAPHFGSDQG
AARFAAVHKVFGASNVSKLLHHIPVNRRHDAVVTISYEAQARLSDPVYGCVSTILALQQQVASLQAELSVVQSQLINSRV
AMANVMQQQTHHQQQQQQLVVMQQPEYSNNSSASTTLAGAAMNRFTVAAEAAAVSYDVMAPTNLEHSLQPPMLRHQQSRG
DHQHEDEEESGGADFSVAVGSTTVASEVIFPAEGFHRR*

DNA
ATGGCTGATCAGCAGCAGCGATCCCACAACACCTCAGATTCTCGCCGGAAATCACTAGCCGGTAAACGAACCTCACAACA
GACTCCGACGACGTCATCTCTAAGTTCCGGTGGAGGAGCCATGGCGGCTACGACGACGACGGGGACAGGAACGGCGTCTC
CTTGCGGGGCTTGCAAGTTCTTGAGAAGGAAGTGTGTGAGTGGATGCATATTCGCTCCACACTTCGGGTCTGACCAAGGA
GCGGCTCGGTTCGCGGCGGTCCATAAGGTTTTTGGAGCCAGCAACGTGTCGAAGCTGTTGCATCATATCCCTGTGAACCG
TCGCCACGACGCGGTTGTTACGATCTCATATGAGGCTCAGGCTCGACTCTCTGATCCTGTCTATGGCTGCGTCTCAACCA
TCCTTGCTCTCCAACAGCAGGTGGCATCGCTACAAGCGGAACTATCGGTGGTGCAATCACAACTTATAAACAGTAGAGTC
GCAATGGCCAACGTTATGCAACAACAAACTCATCACCAACAACAACAACAACAACTAGTCGTTATGCAGCAACCAGAATA
CTCCAACAACTCATCTGCCTCCACCACTCTCGCCGGAGCCGCCATGAACAGATTCACAGTGGCGGCCGAGGCAGCAGCCG
TCAGCTATGACGTCATGGCTCCGACTAACTTAGAACATTCGCTGCAGCCGCCAATGCTACGGCATCAGCAAAGCAGAGGA
GATCATCAGCACGAGGACGAGGAAGAGAGCGGTGGTGCTGATTTCTCGGTGGCTGTTGGATCTACGACGGTTGCTTCTGA
AGTTATCTTTCCGGCGGAGGGTTTTCACCGGAGATGA