Details for Capsella Locus Carubv10015414m

Position : scaf_3 ( 5`- 8664548 .. 8667057 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015414m

Protein [Map View]
MQHMFLSLTQTVARLFVTRFLGQFISIGCVMILEGERMFVFGEKDSTCSLKSILKIHCPQFYWKVMTQADLGLADAYISG
DFSFVDKDSGLLNLIMGWWTPMFLTAGLASAKYYLKHVSRQNTLTQARKNISCHYDLSNEFFSLFMDDTMMYSSAVFKSE
NEDPRTAQMRKISLLIEKARIERNHEVLEMGCGWGTLAIEVVKRTGCKYNGITLSIEQLKYAETKAKEAGLQDQITFELC
DYRQLSDARKYDRIIACEMIEAVGHEFMEKFFSCCEAALAQNGIFVLQFTAIPEKLYDESRLSSGFITEYIFPGGCLPSL
ARVTSAMASSSRLCIENVENFGIHYYHTLRCWRKNFLERQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLKNYQIVFS
RPGNLAAFGDDDPFSSSPTQKKQY*

DNA
ATGCAACATATGTTCCTTTCCCTAACCCAAACAGTGGCTCGGCTTTTCGTTACTAGATTCTTGGGACAATTCATATCGAT
CGGTTGTGTAATGATACTAGAAGGAGAAAGGATGTTTGTATTCGGAGAAAAAGACTCTACTTGTTCTTTGAAATCTATCC
TTAAGATTCACTGTCCTCAGTTTTACTGGAAGGTTATGACACAAGCGGATTTAGGACTAGCAGATGCTTATATCAGTGGA
GATTTTTCATTCGTCGATAAAGACTCAGGGCTTTTAAATCTGATAATGGGATGGTGGACGCCAATGTTTCTAACTGCCGG
TTTAGCGTCTGCAAAGTATTATCTAAAGCATGTCTCTAGACAGAACACTCTAACTCAAGCTCGAAAGAACATTTCTTGTC
ACTATGACCTTAGCAACGAGTTTTTCAGTCTCTTCATGGATGATACAATGATGTACTCCTCTGCAGTATTCAAGTCAGAA
AATGAGGATCCTAGAACTGCACAGATGAGAAAAATATCTCTTTTAATTGAAAAGGCGAGGATAGAGAGGAACCATGAGGT
TTTAGAGATGGGATGCGGATGGGGAACTTTGGCTATAGAAGTTGTGAAAAGAACTGGATGCAAATACAATGGGATTACTC
TTTCTATAGAACAGCTTAAATATGCAGAAACAAAAGCGAAAGAAGCTGGACTTCAGGATCAGATTACATTTGAGCTTTGC
GATTATCGTCAACTGTCTGATGCTCGAAAATATGACAGAATTATAGCTTGCGAGATGATAGAAGCGGTTGGCCATGAGTT
TATGGAGAAGTTTTTCAGTTGCTGTGAAGCTGCGCTTGCACAAAACGGCATTTTTGTACTACAGTTCACAGCGATACCGG
AAAAGTTATACGATGAGAGCAGACTAAGTTCAGGTTTCATAACAGAATACATATTCCCAGGTGGATGTCTTCCTTCTTTA
GCTAGAGTAACTTCAGCCATGGCCTCTTCCTCTAGGCTATGCATCGAGAACGTTGAGAATTTTGGGATTCATTACTACCA
CACGTTGAGATGCTGGAGGAAGAACTTCTTGGAGAGACAGAAACAAATCATGGATCTTGGATTCGACGATAAATTCATAA
GGACATGGGAATATTATTTCGACTACTGTGCAGCTGGTTTCAAGACTCTTACCCTTAAAAACTACCAGATAGTATTTTCA
CGCCCAGGGAACTTAGCTGCATTTGGTGATGATGATCCATTTAGCAGCTCCCCAACGCAGAAAAAACAATATTAG