Details for Capsella Locus Carubv10015407m

Position : scaf_3 ( 5`- 5256022 .. 5256591 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015407m

Protein [Map View]
MAARFLVKRLTAVNVSSTPGGDFSGYVLRQATTGINYFSTGYKQTEGTTHYGQGSNTANDDKSTASYVSDKAKEGVKKAT
DAAINAGDNMKDTMEGAWKAAKETGQNISDAVAGDDDGRIQEDKVAVELKDVQQPVDTTEYRGVEDLHQQTGGEVKSP*

DNA
ATGGCGGCTAGGTTTTTGGTGAAAAGACTCACGGCGGTGAATGTTTCAAGTACTCCGGGGGGAGATTTCTCCGGTTACGT
TCTCCGTCAAGCTACAACCGGAATCAACTACTTCTCAACCGGATATAAGCAAACGGAGGGCACTACTCACTATGGTCAAG
GCTCGAACACTGCAAACGACGATAAGTCCACAGCGAGTTACGTATCAGACAAGGCAAAGGAAGGAGTGAAAAAAGCGACC
GACGCAGCGATCAATGCCGGCGATAACATGAAGGATACGATGGAAGGGGCCTGGAAAGCGGCCAAGGAAACGGGTCAAAA
CATTAGTGATGCGGTTGCCGGTGATGATGATGGTAGGATTCAAGAGGATAAGGTGGCGGTGGAGTTAAAGGATGTTCAAC
AGCCTGTGGATACCACGGAGTATAGAGGTGTAGAGGATCTACATCAGCAAACTGGCGGCGAAGTTAAGTCACCCTAA