Details for Capsella Locus Carubv10015403m

Position : scaf_3 ( 5`- 9597727 .. 9600242 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015403m

Protein [Map View]
MQRRFLSSISGTAGNSKTLNQGRWSVKQVKKSNFHVTLDEIRTSIESSDFIALSLQNTGSYAAAWHRVSAIDTPQTSYLK
AKYAAERYQIFQFALCPFSLQGSKLTVHPYNFHLFPRDELKCGMPSYSFSCQASRLTSMAREGFDFNTCIYEGISYLSRA
QESASKYLSGNPILANPITVSSSPASVADTVFVGRIRSRVKNWRQSCIDSGSKTGDDDLVSSLRRLVLGSEQYGSRLCLT
IDVCSERQVQLILEMLTEFSEDVVPLLVASKSRGTQAVRTVFMSSKEDKDLFKREIQDLENKENRRVRGFREVIDLISSS
QKPVISQNYLSDLTSIHAKFLGPLPANVDDFSSSLSSAFPNVVDLSQFMKEISPLSNISNLPAAMSSLNRFFAPVDVEVA
NQGCPVKLSENYQSHGQNAVMISQLFAKLSAIQKSDLSTVQSNEDSQDLASDEHTSFVISKNTGNENVKVWSKNSRRVSS
ENLVFIWGFAKKLTAAKLKNFLQKSHPVFTQEFDVKYLDRSCAIVVFWESGPSETFLSAVNNEEQLSGSLREMVAEGLRA
AGYETYKRACRLGFWEADLAESLDKTLDSSDTEHDSDTKPSEINWSNDLAINFDEL*

DNA
ATGCAAAGGCGCTTCCTTTCGTCAATCTCCGGCACCGCCGGAAATAGTAAAACCCTAAATCAAGGAAGATGGAGTGTGAA
GCAAGTGAAAAAATCTAACTTTCATGTAACCCTCGATGAGATTCGTACTTCCATTGAGTCATCAGACTTCATAGCTCTCT
CACTACAAAACACCGGCTCATACGCCGCCGCGTGGCACCGTGTCTCCGCCATTGATACGCCGCAAACTAGCTACTTGAAA
GCTAAATACGCCGCCGAACGTTACCAGATTTTTCAGTTCGCTCTCTGCCCTTTCTCTCTTCAAGGCTCCAAACTCACTGT
TCATCCATATAACTTTCATTTGTTTCCTCGGGATGAATTGAAGTGTGGGATGCCTTCTTATAGCTTCTCTTGTCAAGCTT
CACGTTTAACATCAATGGCTAGAGAAGGGTTTGATTTCAACACCTGCATCTATGAAGGAATCTCATACTTGTCTAGAGCA
CAAGAGTCTGCGTCGAAGTATCTCTCGGGGAATCCGATATTAGCTAATCCTATCACTGTATCTTCTTCTCCAGCTAGTGT
AGCTGATACTGTCTTTGTTGGAAGGATTAGATCACGTGTCAAGAATTGGAGACAATCTTGTATAGACTCGGGCTCAAAGA
CTGGAGATGATGATTTAGTGAGCTCTCTGAGAAGACTGGTACTAGGGAGTGAGCAGTATGGTTCAAGGCTGTGTTTGACT
ATTGATGTTTGCAGTGAGCGTCAAGTGCAACTCATTCTAGAGATGTTGACTGAGTTCTCTGAAGATGTTGTCCCTCTACT
CGTTGCTTCGAAGAGCAGAGGAACACAAGCAGTTCGTACTGTCTTTATGAGTTCGAAGGAAGACAAGGATCTTTTTAAGA
GGGAGATTCAAGATCTTGAAAACAAAGAAAACAGGCGAGTTCGTGGCTTCCGGGAAGTGATCGATTTGATTTCTTCTTCA
CAAAAACCTGTCATTTCACAGAATTATCTTAGTGATCTTACTTCCATTCATGCCAAATTCCTGGGTCCTCTACCTGCAAA
TGTGGATGACTTCAGCAGTTCACTGAGCTCCGCATTTCCCAATGTTGTGGATCTCAGTCAGTTCATGAAAGAAATTAGTC
CTTTAAGTAATATAAGTAATCTACCTGCAGCTATGTCCTCTTTGAATCGGTTCTTTGCACCTGTGGATGTGGAAGTCGCA
AATCAAGGCTGTCCGGTCAAATTAAGCGAGAACTACCAGAGTCACGGGCAGAATGCTGTGATGATATCTCAGCTTTTTGC
AAAACTGTCTGCCATACAGAAATCAGATCTATCAACTGTCCAATCAAATGAAGATTCCCAAGATTTGGCTTCTGATGAAC
ACACAAGCTTTGTCATCTCTAAAAACACAGGCAATGAGAATGTTAAAGTCTGGTCAAAGAATAGCCGGAGAGTAAGCTCT
GAGAACTTGGTGTTCATATGGGGATTTGCGAAAAAATTGACAGCTGCAAAGCTGAAGAACTTTCTACAAAAGTCACACCC
CGTCTTTACGCAAGAGTTTGATGTTAAGTACTTAGACAGGAGCTGTGCAATTGTGGTATTTTGGGAGTCAGGTCCTTCAG
AAACTTTCCTCAGTGCTGTTAACAATGAAGAGCAACTTAGTGGTTCTTTAAGAGAGATGGTTGCTGAAGGGTTAAGAGCA
GCAGGCTACGAGACTTACAAGAGAGCTTGTAGATTAGGCTTTTGGGAGGCTGACTTAGCGGAATCTTTAGACAAAACATT
GGACTCTTCAGATACAGAACATGATTCTGACACCAAACCATCAGAGATTAATTGGTCAAACGATTTAGCTATCAATTTTG
ATGAGCTATGA