Details for Capsella Locus Carubv10015399m

Position : scaf_3 ( 5`- 3429702 .. 3431144 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015399m

Protein [Map View]
MSSDAEFCHDRISALHEDLLVQILTLVPVKDAVKTMVLSKRWSFLWTMMHRLDYIEKDRDEKIVWDFLDKSLQLNKAPVL
ESLRIRIHRQCPLVDADLGKWVSVAVERCARELILILCHLSDPTSLPKRLYTCKTLVQLILSDKILVDVPSPACFPSLKF
LVLSRVVYKDQDSHVKLLSSCPVLRQLLVVRTKRDNVNRFSVKVPSLLLLTYVYFPLPDNNDDKPLVIDSPGLIFVNITV
ADPLRDSFSIKNMPRLEGAIISLYGYPPNNELNFMTSFSSVRILSLRSLKVGCCNAINFPRLIELKLCLPSSEHHWMEPL
MLLLHNAPKLKTLRINSVIPFYIFKAFIVYPEDVQLSWNQPSSVPGCLLSQLEIFEWRGYKRRSEEKQFAAYILANSTCL
NTVGISPTSSCGDEKEKPN

DNA
ATGTCATCAGATGCTGAGTTTTGCCACGACAGGATCAGTGCGTTGCATGAGGATTTATTGGTGCAGATATTGACTCTAGT
CCCAGTAAAAGATGCAGTGAAAACCATGGTTTTGTCGAAACGATGGAGTTTTCTCTGGACAATGATGCATAGACTTGACT
ACATAGAAAAAGACAGAGACGAGAAGATCGTTTGGGACTTCCTTGACAAGTCACTGCAACTGAACAAGGCACCTGTACTA
GAAAGCTTGCGTATCAGAATCCATCGACAATGTCCTCTTGTCGATGCAGATCTCGGAAAGTGGGTCTCGGTTGCAGTTGA
ACGCTGCGCTCGAGAACTAATTCTAATTCTTTGCCATCTCTCCGATCCTACCAGCTTGCCTAAGAGGCTTTACACCTGCA
AAACGCTTGTGCAATTGATTCTATCCGACAAGATTCTCGTTGATGTTCCTTCTCCGGCTTGCTTCCCGTCCCTTAAATTT
CTGGTCCTTTCCCGTGTGGTGTATAAAGACCAAGATTCTCATGTTAAGCTTTTATCGAGTTGCCCTGTTCTAAGACAGTT
GCTTGTGGTTCGAACCAAGCGTGACAATGTGAACAGGTTCAGTGTGAAAGTTCCTTCTTTATTGTTGTTAACGTATGTGT
ATTTCCCATTACCTGACAATAACGATGATAAGCCCTTGGTTATAGATTCCCCTGGATTAATTTTTGTAAACATTACTGTC
GCTGACCCTTTAAGAGACTCTTTCTCGATCAAGAACATGCCACGCCTTGAAGGGGCCATCATATCTCTCTATGGTTATCC
CCCGAACAATGAGTTAAACTTTATGACATCTTTTTCCTCTGTCAGGATTCTCAGTTTACGTTCGTTAAAGGTTGGTTGTT
GTAATGCCATTAACTTCCCCCGGCTTATAGAGTTGAAGTTGTGTCTTCCTTCCTCAGAGCATCATTGGATGGAGCCACTT
ATGCTTTTGCTTCATAATGCTCCGAAACTAAAAACTCTCAGGATCAACTCTGTAATACCTTTCTACATCTTCAAAGCTTT
CATTGTTTACCCTGAAGATGTCCAACTTTCATGGAACCAACCGAGTTCGGTGCCGGGATGTTTGTTGTCTCAACTTGAGA
TCTTTGAGTGGAGAGGATACAAACGAAGAAGTGAAGAGAAACAATTTGCGGCGTATATCCTCGCAAACTCAACGTGTTTA
AATACGGTGGGAATCTCACCAACATCTTCATGCGGAGATGAAAAAGAGAAACCGAAC