Details for Capsella Locus Carubv10015398m

Position : scaf_3 ( 5`- 5568955 .. 5572061 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015398m

Protein [Map View]
MWSNGLFLTLFTLSLLLGQSCCATDTLLQGQYLKDGKELNSPFSIFKLKFFNFKNSSSWYLGIWYNNFYLSGNKKYDGDI
YDRAVWIANRNNPILGRSGSLTVDSLGRLSILRGASSLLELSSTETTGNTTLKLLDSGNLQLQEMDSDGSMRRILWQSFD
YPTDTFLPGMKLGFNVKTGKRWELTSWLGDTLPASGSLVFGMDANIPNLLTISWRGNMYWASGLWFKGRFSLEELPLTFI
STETEHYFMYSSEQYDAQTFFPAIMIDQQGNLHINRLDKRLHVRCPPFTEESNWKCYRQDTRDCLYAGCIVPYDPYGLSY
SFRETISAFSSNGFVLSETGGRFSSADCHAICMLNSSCLAYASTKLDGTGCEIWNSDPTNKKSSSQSPRTIYIRLKENEK
AATWLVVVASLFLIIPLTWFIIYLVLRKFKIKVIGCIRRRLPTLRVGPTIDQEMLLRELGIDRSRRGKRSARKNNNELQI
FSFESVALATDFFSDGNKLGEGGFGPVYKGKLTDGEEVAIKRLSLASGQGLVEFKNEAMLIAKLQHTNLVQLLGCCVEKD
EKMLIYEYMPNKSLDYFLFDPLRKNVLDWTLRFRIMEGIIQGLLYLHKYSRLKVIHRDIKASNILLDEDMNPKISDFGMA
RIFGAQESKANTKRVAGTFGYMSPEYFREGLFSAKSDVFSFGVLMLEIICGRKNNSFHHDSEGPLNLIVHVWNLFRENRI
SEVVDPSWGDPAVPNPQVLRCLQVALLCVQESAEERPSMLDVVSMIYSDGNNALCLPKEPAFYDGPRRSSPEMDVEPQEV
ENVSANRVTITVMEAR*

DNA
ATGTGGTCAAATGGCCTCTTTCTCACTCTTTTTACTTTGTCTCTCTTGTTAGGGCAATCATGCTGTGCAACAGATACGCT
ACTGCAGGGTCAGTACTTGAAAGATGGGAAAGAGCTAAATTCGCCTTTCAGTATCTTCAAGCTCAAGTTTTTCAACTTCA
AGAATTCAAGCAGCTGGTATCTTGGAATTTGGTACAACAACTTTTATCTTAGTGGTAATAAGAAGTATGATGGTGATATC
TATGACAGAGCTGTTTGGATTGCTAACCGTAACAATCCTATTTTGGGACGCTCTGGAAGCCTTACAGTGGACTCTCTTGG
CAGATTGAGTATTTTAAGAGGAGCATCAAGCCTTCTTGAGCTGAGTTCTACGGAAACCACAGGAAACACAACCCTTAAGC
TTTTGGATTCTGGAAATCTTCAGCTCCAGGAGATGGATTCTGATGGATCGATGAGGCGGATTTTGTGGCAAAGTTTTGAT
TATCCAACAGATACCTTTCTCCCTGGGATGAAACTTGGTTTCAATGTCAAGACCGGGAAGAGATGGGAACTGACATCATG
GCTAGGTGATACTTTACCTGCTTCTGGATCTCTTGTCTTTGGGATGGATGCCAATATTCCCAACCTATTGACCATCTCGT
GGCGTGGAAACATGTATTGGGCAAGTGGGCTCTGGTTTAAGGGTCGATTTTCTTTGGAAGAATTGCCCTTAACCTTCATT
TCAACCGAGACTGAACACTATTTTATGTATTCAAGTGAACAATACGATGCCCAAACATTTTTTCCCGCTATAATGATAGA
CCAACAGGGAAATTTGCATATAAACAGGCTGGACAAGCGTTTGCATGTTCGTTGTCCTCCTTTCACTGAAGAAAGTAACT
GGAAGTGTTACAGGCAGGATACTAGAGATTGTTTGTACGCAGGTTGCATAGTCCCATATGACCCATATGGGCTAAGCTAT
TCTTTCAGAGAGACGATATCGGCTTTCTCCAGCAATGGATTTGTACTTAGTGAGACTGGTGGAAGGTTTAGTTCAGCTGA
TTGTCATGCTATATGTATGCTTAACTCTTCTTGTCTTGCCTATGCTTCAACCAAATTGGATGGTACGGGTTGCGAAATCT
GGAATAGTGATCCTACCAACAAAAAGTCGTCTTCTCAAAGTCCCAGAACTATATATATTCGTTTAAAAGAGAACGAAAAG
GCGGCAACTTGGCTAGTTGTTGTGGCATCACTATTCCTAATTATACCTCTGACTTGGTTTATCATCTATCTTGTTCTAAG
GAAATTTAAAATAAAAGTTATTGGTTGTATACGGAGGAGGCTTCCAACATTGAGGGTTGGTCCAACTATAGACCAAGAAA
TGCTACTACGTGAATTGGGAATTGATAGGAGCCGCCGAGGCAAGAGAAGTGCAAGGAAGAATAATAATGAACTTCAGATC
TTTAGTTTTGAAAGTGTTGCCTTGGCAACAGATTTCTTCTCTGATGGAAACAAGCTCGGTGAAGGAGGTTTTGGTCCTGT
ATATAAGGGGAAGTTAACAGATGGGGAAGAAGTGGCTATCAAGAGACTATCATTAGCATCCGGACAAGGATTAGTGGAGT
TCAAGAACGAAGCTATGCTTATTGCAAAACTTCAGCACACAAATCTTGTTCAGTTGCTAGGATGCTGCGTAGAGAAGGAC
GAGAAAATGTTGATTTATGAATACATGCCCAACAAGAGTCTTGACTACTTCCTCTTTGATCCCTTGAGAAAAAACGTTCT
GGATTGGACGCTGCGGTTCAGGATCATGGAAGGGATAATTCAAGGACTTTTGTACCTTCACAAGTACTCGAGACTGAAAG
TGATACACAGAGACATCAAAGCCAGCAACATCTTGCTGGACGAGGATATGAATCCCAAGATATCAGATTTCGGAATGGCT
CGGATATTTGGAGCGCAAGAATCCAAAGCCAACACCAAAAGAGTTGCTGGCACATTTGGATATATGTCTCCGGAGTACTT
CAGAGAAGGACTATTCTCGGCGAAATCAGATGTGTTCAGCTTCGGAGTTCTAATGCTCGAAATTATTTGTGGAAGGAAAA
ACAATAGCTTCCACCATGACTCAGAAGGACCTCTAAATCTCATAGTCCATGTATGGAATCTGTTTAGAGAGAACCGAATA
AGCGAAGTCGTAGATCCGTCTTGGGGAGATCCTGCAGTTCCTAACCCTCAAGTGTTGAGATGTTTACAAGTTGCTCTGTT
GTGTGTACAAGAAAGCGCAGAAGAAAGACCAAGTATGTTAGACGTTGTTTCGATGATATACAGCGACGGCAACAATGCTC
TTTGTTTGCCTAAAGAGCCAGCTTTCTATGATGGTCCCCGGAGAAGCTCACCGGAGATGGATGTTGAGCCACAGGAGGTA
GAAAATGTATCGGCCAATAGAGTTACTATCACAGTAATGGAAGCAAGGTGA