Details for Capsella Locus Carubv10015392m

Position : scaf_3 ( 5`- 7573464 .. 7576018 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015392m

Protein [Map View]
MAQCVRSTLDPLRTPKSVTRTVSVKTPAFASGKAQNQQEGRPQLSLDDLVTSNRKGEVLGTIKDSLSNCLSETNLLETVP
GLKSRIRGKVRDIYDAGDYLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNNTQHITPNAIVSSPDRNVVIAKKCSV
FPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNELSYGLVKNQKLPANILTPTTKAADHDVPISPNEIVERGFMTQADFD
EASMKALSLFEFGQRVAKHHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEERFQKGLEPENVDKEFLRLW
FKENCNPYEDEILPAAPAELVTELAWRYIFLYETITGSRTDIIPTQEPIHDRISRNTRQTLSSLGQL*

DNA
ATGGCTCAGTGTGTGAGGTCAACTCTAGATCCTTTGAGAACACCCAAGAGCGTTACTAGGACAGTGTCTGTAAAAACCCC
AGCTTTTGCGTCAGGCAAGGCCCAAAACCAGCAGGAGGGGAGACCACAACTGTCTCTTGATGATTTAGTCACGAGTAACC
GAAAGGGAGAGGTTCTTGGCACAATCAAAGACTCGCTGTCAAATTGTCTCTCTGAGACGAATCTTCTAGAGACTGTTCCT
GGTCTGAAATCTAGAATCAGGGGAAAGGTCAGAGATATTTATGATGCTGGTGATTATCTGGTTCTTATTACAACTGATCG
GTTGAGTGCATTCGACAGAAATCTTGCTTCAATTCCCTTCAAAGGCCAGGTTCTTAATGAGACAAGTTTGTGGTGGTTCA
ATAACACACAGCACATAACTCCAAATGCAATTGTTTCATCTCCTGATAGAAATGTTGTTATCGCAAAGAAATGCTCGGTT
TTTCCCATAGAGTTTGTGGTTAGAGGATATGTGACTGGAAGTACTGACACGTCATTATGGACGGTTTACAATAAAGGTGT
TCGGAACTACTGTGGGAATGAGCTCTCATATGGATTAGTAAAAAACCAGAAGCTTCCAGCTAATATACTTACACCAACAA
CTAAGGCAGCGGATCATGATGTGCCCATCTCTCCAAATGAGATAGTTGAACGTGGATTCATGACTCAAGCTGATTTTGAT
GAAGCAAGTATGAAAGCTTTGAGCTTGTTTGAGTTTGGGCAGCGGGTTGCCAAGCATCATGGACTGATACTGGTGGACAC
AAAGTATGAGTTTGGAAGAAGTAGTGATGGCTCAATCTTATTGATTGATGAGATTCATACACCCGATTCCAGCAGATACT
GGCTTGCAGGTTCATATGAAGAGCGCTTTCAAAAAGGCCTGGAGCCTGAAAATGTTGATAAGGAGTTTCTAAGATTGTGG
TTCAAAGAGAACTGCAATCCGTATGAGGACGAGATCCTGCCAGCTGCCCCTGCAGAACTCGTGACTGAATTAGCTTGGCG
GTACATTTTCTTGTATGAAACTATTACTGGATCAAGAACTGACATTATTCCAACTCAGGAACCGATACATGACCGGATCT
CAAGAAACACAAGACAAACACTTTCATCTCTCGGTCAACTTTGA