Details for Capsella Locus Carubv10015380m

Position : scaf_3 ( 5`- 2566553 .. 2568710 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015380m

Protein [Map View]
MGTWKTRSSSNKKKVCYISVPALIIKSVSSSSLHSFLHNRSSKKNTNKFFNLVNPKLWALLLFLLTILGISLRLGLCLSP
FGFGDHKSQLQSSDSNVPPKSHLSIAFRRSNTTQVEISNAKDRSLDTGVEKNETFGGVQSHLITSNGNGQGDIYEFWKQP
DGLGYKPCLDFSIGYRRESKKIATERRRYLMVVVSGGLNQQKIQIVDAVVIARILGAVLVVPILQINLIWGDESEFSDIF
DLEQFKSVLANDVKIVSLLPASKLMTRPSEEGGMPFNASPQWIRSHYLKRFNKEGVLLLRRLDSRLSKDLPSDLQKLRCK
VAFEALKFSPRVMEMGKKLAERMRSKGPYIALHLRMEKDVWVRTGCLSGLSSKYDEIVNMERIKRPELLTAKSSMTSNER
KLAGLCPLNAKEVTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRASIMAAIDYI
VCKESDVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFANTSMSKTEFEKMIKKLHRQSLGQPELRISKAGRDV
TKYPVPECMSNQVTSTII*

DNA
ATGGGAACATGGAAGACGAGAAGCAGTAGTAATAAGAAGAAAGTTTGCTACATTTCAGTCCCAGCTCTGATCATAAAATC
AGTTTCCTCGTCGTCTTTGCACTCTTTTCTCCATAACAGATCTTCAAAGAAGAACACAAACAAATTCTTCAATCTCGTAA
ACCCAAAGCTCTGGGCTTTACTTCTCTTCTTACTTACTATTTTGGGCATATCGTTAAGACTCGGTCTTTGTCTTTCTCCT
TTTGGTTTCGGCGATCACAAAAGTCAACTTCAGAGCTCAGATTCTAATGTACCTCCTAAATCCCATCTGAGTATTGCGTT
TAGACGATCAAACACTACTCAAGTTGAGATTTCCAACGCCAAGGATCGATCTTTGGATACAGGTGTGGAGAAAAATGAGA
CCTTTGGTGGTGTTCAATCACATTTGATCACCTCTAATGGAAATGGACAAGGTGATATTTATGAGTTCTGGAAACAGCCT
GATGGATTAGGTTACAAGCCATGCTTAGATTTCAGCATTGGATACAGAAGAGAGAGTAAGAAGATTGCTACAGAGAGGAG
AAGGTATCTGATGGTGGTTGTCTCTGGTGGGTTGAATCAGCAGAAGATTCAGATTGTTGACGCAGTTGTGATTGCGAGGA
TTCTAGGTGCTGTTCTTGTTGTACCAATATTGCAAATCAATCTCATTTGGGGTGACGAAAGTGAGTTTTCAGATATATTT
GATTTAGAGCAATTCAAGAGTGTTTTAGCAAATGATGTGAAGATAGTTTCGTTGCTTCCCGCAAGTAAGCTAATGACTAG
ACCATCAGAAGAAGGTGGTATGCCCTTTAACGCCTCCCCTCAATGGATCCGTTCGCACTATCTAAAGCGTTTCAACAAGG
AAGGAGTTCTGCTTTTAAGGAGATTAGATTCAAGGTTGTCTAAAGACTTACCCTCTGATCTCCAGAAGCTTCGTTGTAAG
GTAGCCTTTGAAGCACTAAAGTTTTCGCCACGGGTGATGGAGATGGGGAAGAAGCTTGCAGAGAGGATGAGGAGCAAAGG
GCCTTACATTGCGTTGCATCTTCGAATGGAGAAAGATGTATGGGTGAGAACAGGCTGCCTCTCTGGTTTGAGCTCAAAGT
ATGATGAGATTGTAAACATGGAAAGGATTAAGCGGCCTGAGCTCCTAACAGCCAAATCTAGTATGACATCTAACGAGAGG
AAACTCGCAGGTCTCTGTCCATTAAATGCCAAGGAAGTAACAAGACTGCTTAGAGCTCTTGGAGCACCAAGAGATGCAAG
GATCTATTGGGCGGGAGGGGAACCGCTTGGCGGAAAAGAAGCTTTGAAACCGTTAACAAGTGAATTCCCACATCTCTACA
ACAAGTACGATATTGCATTGCCTCTTGAACTCAAACCTTTTGCAAAACGAGCTTCGATAATGGCAGCAATCGACTATATA
GTGTGTAAGGAGAGTGATGTGTTTATGGCATCTCATGGAGGGAACATGGGCCATGCAATTCAGGGGCACAGGGCTTATGA
AGGACACAAGAAAATTATAACACCAAACAAAAGGCACATGCTTCCATACTTTGCGAACACATCAATGAGTAAAACAGAGT
TTGAGAAGATGATAAAGAAATTACACAGACAATCTCTAGGACAGCCAGAACTAAGGATTAGCAAAGCTGGAAGAGATGTA
ACAAAGTATCCTGTTCCTGAGTGTATGAGCAATCAAGTCACCTCTACGATAATTTAA