Details for Capsella Locus Carubv10015376m

Position : scaf_3 ( 5`- 2703790 .. 2704851 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015376m

Protein [Map View]
STCKKWYALITSDKGFMCNHLSHSPERFIRIYDRQIMDPVTGTLSAVSLIIPDEFRDSYPVNSMVHCDGLLLCLCQKWNK
RQLRYANLAVWNPVLRDFKWIEPSVCYRITDFLGFGYDITRAVSRDNYKILRLVVGHCRIRKDEYSDPDCEIYEFKSDSW
RRLDAKYDWKVDDSKCSGVSVKGNMYWIAMKKEHYFIVSFDFSMETFKDICVCPSSWVTRLACFNGDRLSLLLQGEESAG
MEVWMANNLTDKVVSCCQYFKVDTSPGLPPLHIHSEMAKHRNIMVWSETSVDEEDGKCYICIKFYDIGQSGITKQIQTAR
HGQFEYDDPFICSYVYVPSLIPIPLKEEHQVEI*

DNA
TCGACGTGCAAGAAATGGTACGCTCTCATCACCAGCGACAAAGGATTCATGTGCAATCACTTGAGTCACTCTCCGGAACG
ATTCATAAGAATCTACGATCGTCAGATCATGGATCCGGTGACCGGAACCCTCTCAGCAGTTTCATTAATCATCCCGGACG
AGTTTCGCGATTCGTATCCGGTAAATTCTATGGTTCACTGTGACGGACTCTTGCTGTGTTTGTGTCAAAAATGGAATAAG
AGACAATTAAGATACGCAAATCTCGCAGTTTGGAATCCGGTTTTGAGAGATTTTAAATGGATCGAACCGTCGGTTTGTTA
CCGGATCACTGATTTCTTGGGGTTTGGATACGACATTACTAGAGCTGTATCTCGTGATAACTACAAAATCTTGAGGCTTG
TTGTTGGTCATTGCCGTATTCGTAAGGATGAGTATTCAGATCCAGATTGTGAGATCTATGAATTCAAGTCTGATTCGTGG
AGAAGGCTTGATGCTAAGTATGATTGGAAGGTGGATGATAGTAAGTGCAGCGGCGTGTCTGTGAAGGGTAATATGTATTG
GATTGCTATGAAGAAGGAACATTATTTCATTGTAAGTTTTGATTTCTCCATGGAAACATTCAAGGACATTTGCGTTTGTC
CTTCTTCTTGGGTGACTCGGTTGGCCTGTTTCAATGGAGATAGACTCTCATTGTTACTACAAGGTGAAGAATCAGCAGGG
ATGGAGGTGTGGATGGCAAACAATTTGACTGATAAGGTTGTTTCGTGTTGCCAATACTTCAAAGTCGACACTAGCCCTGG
TCTCCCACCGTTACATATCCATAGTGAAATGGCTAAGCACAGGAATATAATGGTGTGGAGTGAGACAAGTGTAGACGAAG
AAGATGGTAAATGTTATATTTGCATCAAGTTTTACGACATTGGTCAAAGTGGGATCACAAAACAAATCCAGACAGCAAGG
CATGGACAGTTTGAGTACGATGACCCGTTTATTTGTAGCTATGTTTATGTTCCAAGTCTGATTCCGATTCCCCTCAAAGA
AGAGCATCAGGTAGAGATTTGA