Details for Capsella Locus Carubv10015370m

Position : scaf_3 ( 5`- 8337818 .. 8338321 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015370m

Protein [Map View]
MFIRVKLPWDVMIAAEDMDTGLTLQRTIVVHLLDAFATKKATKNLGYFITPTILETIGEGKIKEQTGEAVFPVVFNGICF
KMFKGEVLHGVVSKVHKLGVFLRSGPYETIYLSHMKMSDYEFIPGENPVFMNENMSRIQIGTRVRFIVLDTQWREAEKDF
IALASIG*

DNA
ATGTTCATCAGAGTCAAACTGCCATGGGATGTTATGATTGCAGCTGAAGATATGGACACTGGGCTCACGCTCCAGAGAAC
TATTGTCGTTCATCTACTCGATGCCTTTGCTACCAAGAAAGCAACGAAAAATCTTGGATACTTCATAACACCCACAATTT
TGGAGACAATCGGCGAGGGAAAGATCAAGGAGCAGACTGGCGAAGCTGTCTTTCCCGTGGTTTTCAACGGAATCTGCTTT
AAGATGTTTAAAGGAGAGGTTCTTCATGGTGTGGTTAGCAAGGTGCACAAGCTTGGTGTCTTTTTGAGATCTGGCCCTTA
CGAAACCATTTACCTATCACACATGAAGATGTCCGATTACGAGTTCATCCCAGGAGAGAACCCGGTTTTCATGAATGAGA
ACATGTCCCGGATTCAGATCGGCACCAGAGTTCGTTTCATCGTATTAGATACCCAGTGGAGAGAGGCAGAGAAAGACTTC
ATAGCTTTGGCCAGCATCGGATAA