Details for Capsella Locus Carubv10015363m

Position : scaf_3 ( 5`- 550400 .. 551337 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015363m

Protein [Map View]
MRMSCNGCRVLRKGCSEDCSIRPCLAWIKSPEAQANATVFLAKFYGRAGLMNLINAGPDHLRPGIFRSLLHEACGRIVNP
IYGSVGLLWSGNWQLCQDAVEAVMKGEPITEIATDAATIGQGPPLKIYDIRHNSKDDNSAAATGSTDLKRAKTRRAKRVA
ALEKQAESEGKSGGGEASHESSLSHQSEIVAAHEGESKESESNASEVLALSPPTVQGSGEIKLDLTLGLEPVSHAYDVVP
VKKRRIGVFGTCQKESTCKTELML*

DNA
ATGCGGATGAGCTGTAATGGATGCAGAGTTCTCCGGAAAGGGTGTAGTGAGGATTGTAGTATAAGACCCTGTTTGGCTTG
GATCAAGTCTCCTGAAGCCCAAGCTAACGCAACCGTGTTTCTCGCCAAGTTCTATGGCCGTGCTGGACTCATGAACCTCA
TCAACGCCGGTCCCGATCACCTTCGTCCTGGGATTTTCCGATCGTTGTTGCATGAAGCTTGTGGGAGGATCGTGAATCCG
ATCTATGGTTCAGTGGGTTTGTTATGGTCTGGAAATTGGCAGCTTTGTCAAGACGCCGTTGAGGCTGTGATGAAAGGAGA
GCCGATCACAGAGATCGCCACAGACGCGGCGACGATCGGCCAAGGTCCGCCACTTAAGATCTACGACATCAGACATAACT
CCAAAGATGACAACTCCGCTGCCGCTACTGGGTCAACCGATCTGAAACGGGCGAAAACTCGCCGGGCTAAGCGGGTCGCC
GCCCTTGAGAAACAAGCGGAATCTGAGGGAAAGTCCGGCGGCGGTGAGGCTAGTCACGAGTCCTCGTTGAGTCACCAGTC
TGAAATAGTGGCTGCTCATGAAGGAGAGAGCAAGGAATCGGAGAGCAATGCCTCTGAGGTTTTGGCGTTATCGCCGCCGA
CTGTTCAGGGCTCCGGCGAGATTAAGCTCGACTTAACTCTAGGGCTGGAGCCGGTGTCACATGCGTATGACGTGGTACCT
GTGAAGAAGAGAAGGATCGGCGTGTTTGGCACGTGTCAGAAGGAGAGCACGTGTAAGACTGAGCTTATGCTCTAA