Details for Capsella Locus Carubv10015361m

Position : scaf_3 ( 5`- 7001327 .. 7009673 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015361m

Protein [Map View]
MANNPQYPGIQPFQHPNASSLELPRGYDPSMNFQFRPTIQAPHSEQVTRLSSHNFQSVGRGGTVMNIGYPPQSYAPQLLH
HSLERPSQLNKVQPVPLGPPTLISQPNVSISSGASMPPPYVQTPDISMPGFGGPRALFSYPIATSYEGSRAPTQVTGSSS
HNQAQQRASISQTTAQSSIMNPTFEQPKAAFFQPIPSQELLTDWVEHTSADGRKYFFNKRTKRSTWEKPVELMTLFERAD
AGTDWKEHSSPDGRKYYYNKVTKQSTWKMPEEMKTAREQAEKASVQGPQPGGIIDASKVLSRSDTASTEAPTGLPSKTST
SDTSEKLALSSDWKQPASVPGSSSPVENVDGAQMIADKTSLLCDIAETDGPSVTVTKTSAATLVKKDEISVGITGDSDDI
SAKTTNQGSGTAPKESQKHMVESERLESQPEEKQIHQDNFSSNNKLEPGDVFKSLLKSANVGPDWTWEQALREIINDRRY
GALRTLGERKQAFNEFLLQMKRSAEEERLARQRKRYEEFKRMLEECVELAPSMRWSKAVTMFEDDERFKALEREKDRRNI
FEDHINELKEKERVKALEDRKRNIIEYRRFLESCNFIKSNSQWRKVQDRLEVDERCSCLEKIDQLEIFQEYLRDLEREEE
ERQKIQKEELKKAERKHRDEFRGLIDEHIATGELTAKTSWRDYLMKVRDLPVYSAITSNSSGATPKDLFEDALEDLKRKY
HDLKSQIKDVLKFRKVTLYGGSTFDEFKVSISEDISVSSISDVKLKVVFDDLLERVKEKEEKEARKQTRQTEKLVDMLRF
FKDITASSSWEESKHLVEGSERCRTIGDESFRKHTFEDYVSHLKEQSKRMKQHKKVPEDVRDEHDKGKDKYGREKDRVRE
RDSDDHHKKGAADNHNHDMNEPHGRERRRSGRDSYNRHRERHTSVKESETDHLKESHKAGGGHKKSREQRGLVPEAEDEG
REKRRRKEEESEKTKVEELEDGECGRY*

DNA
ATGGCTAATAACCCTCAGTATCCTGGCATTCAGCCATTCCAGCATCCTAATGCGAGTTCCTTAGAATTACCCCGAGGCTA
TGATCCATCCATGAACTTTCAGTTTCGTCCTACCATTCAAGCTCCGCATTCTGAGCAAGTTACTCGATTGTCTTCTCATA
ACTTTCAATCTGTTGGCAGAGGTGGCACAGTGATGAACATTGGATATCCACCTCAATCTTACGCACCTCAGTTATTACAT
CATTCCCTTGAAAGACCTAGCCAATTAAATAAGGTGCAACCTGTGCCACTTGGACCCCCAACTCTAATTTCACAGCCAAA
TGTGTCAATTTCTTCTGGTGCCTCCATGCCTCCGCCTTATGTGCAAACTCCAGATATTAGTATGCCTGGTTTTGGAGGGC
CAAGGGCACTCTTTTCTTATCCGATTGCAACATCTTACGAAGGTTCGAGGGCACCAACTCAAGTCACTGGATCAAGCAGT
CATAATCAGGCACAACAGAGAGCATCTATCAGCCAGACAACTGCACAATCTTCTATCATGAATCCGACATTTGAACAACC
TAAGGCAGCTTTTTTTCAACCTATCCCTTCTCAAGAGCTTCTAACAGATTGGGTTGAGCATACCTCTGCGGATGGAAGGA
AATATTTTTTCAACAAGAGGACAAAGCGGTCCACTTGGGAGAAGCCTGTTGAGTTGATGACTCTTTTTGAGAGAGCAGAT
GCAGGAACTGACTGGAAAGAACATTCAAGTCCTGATGGAAGAAAGTATTACTACAATAAAGTTACCAAGCAATCAACATG
GAAAATGCCTGAAGAGATGAAGACTGCGCGTGAACAAGCAGAAAAAGCATCTGTTCAAGGACCTCAGCCAGGAGGCATTA
TTGATGCTTCTAAGGTGCTGTCTCGTTCTGATACTGCATCGACTGAAGCTCCTACTGGTCTACCAAGCAAAACATCAACC
TCTGATACCAGTGAGAAACTAGCTCTTTCTTCTGATTGGAAGCAGCCAGCTTCAGTTCCTGGAAGTTCTTCTCCGGTCGA
AAATGTTGATGGAGCTCAGATGATTGCAGATAAAACATCACTATTGTGTGATATTGCAGAAACTGATGGTCCTTCTGTCA
CTGTGACGAAAACTTCTGCTGCTACATTGGTTAAGAAGGATGAAATTTCAGTTGGGATCACTGGAGATTCAGATGACATA
TCAGCTAAAACCACAAATCAAGGTAGTGGGACTGCACCAAAAGAAAGCCAAAAACATATGGTGGAAAGTGAAAGACTTGA
GAGCCAACCAGAAGAAAAACAAATTCATCAAGATAATTTTTCTAGTAATAATAAATTGGAACCCGGGGATGTATTCAAAT
CACTTTTAAAATCCGCCAATGTTGGACCTGACTGGACATGGGAACAGGCCTTGAGAGAAATTATTAATGACAGAAGATAC
GGTGCGCTAAGGACTCTTGGAGAGCGGAAGCAAGCCTTCAATGAGTTCTTACTTCAAATGAAACGATCAGCTGAAGAGGA
AAGGCTAGCGAGACAGAGAAAACGGTATGAAGAATTTAAAAGGATGTTAGAGGAATGTGTGGAGCTTGCTCCTTCAATGC
GGTGGAGCAAGGCTGTGACAATGTTTGAAGACGATGAGCGGTTCAAAGCTCTTGAACGAGAAAAAGACCGTCGTAATATT
TTTGAAGATCACATCAATGAGCTAAAGGAGAAGGAGCGGGTGAAAGCTCTTGAGGATCGCAAGCGGAACATAATTGAATA
CAGAAGATTTTTGGAATCTTGCAATTTCATCAAGTCTAATAGTCAATGGCGCAAAGTTCAGGACCGCCTAGAAGTGGATG
AACGATGTTCATGCCTTGAGAAAATTGATCAGCTGGAAATCTTTCAGGAATATCTGCGTGATCTAGAGAGGGAAGAAGAG
GAGAGACAGAAGATACAGAAGGAGGAGCTAAAAAAAGCAGAGAGAAAGCATCGTGATGAGTTCCGTGGGCTGATAGATGA
ACATATTGCAACAGGAGAGCTTACTGCCAAAACCAGTTGGCGTGATTATTTAATGAAGGTCAGAGATTTACCAGTATATT
CAGCAATTACCTCGAATTCATCTGGAGCTACTCCAAAAGACTTATTTGAAGATGCGCTTGAGGATTTGAAAAGAAAGTAT
CACGATCTCAAGTCTCAGATAAAGGATGTATTGAAGTTCAGAAAGGTAACATTATATGGTGGATCGACATTTGATGAGTT
CAAGGTCTCCATTTCCGAGGATATCAGTGTCTCATCTATTTCAGACGTTAAACTAAAGGTAGTTTTTGATGATTTGCTGG
AAAGGGTAAAGGAGAAGGAAGAAAAAGAAGCCAGAAAACAGACACGGCAGACTGAAAAATTGGTGGATATGCTTCGCTTT
TTTAAGGATATAACTGCCTCTTCATCCTGGGAGGAATCAAAGCATCTAGTTGAAGGTAGTGAAAGATGCCGTACTATTGG
CGATGAGAGCTTCCGGAAGCATACATTTGAAGATTATGTATCACACCTCAAAGAGCAATCAAAAAGGATGAAACAGCACA
AGAAGGTACCCGAGGATGTGAGAGATGAACATGACAAGGGGAAAGATAAATACGGAAGAGAAAAGGACAGAGTCCGAGAA
AGAGACAGTGATGATCATCATAAGAAAGGTGCAGCTGATAATCACAACCATGATATGAATGAACCCCATGGAAGAGAACG
TAGAAGATCAGGAAGAGATAGCTATAACAGACATCGAGAAAGACATACTAGTGTGAAGGAAAGTGAGACAGACCATCTCA
AAGAATCCCATAAGGCTGGTGGTGGCCACAAGAAATCAAGAGAACAGCGAGGTTTGGTCCCTGAAGCAGAGGATGAAGGC
AGGGAAAAGCGGCGTAGAAAAGAGGAAGAGAGTGAGAAAACAAAGGTAGAGGAGCTTGAAGATGGAGAATGTGGTAGGTA
TTGA