Details for Capsella Locus Carubv10015357m

Position : scaf_3 ( 5`- 2824609 .. 2826672 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015357m

Protein [Map View]
MVVFPKSLSPKHVLKLLNSEKNPRAAFALFDSATRHPGYAHSAVVYHHILRRLSEARMVNHVTRIVELIRSQGCKCDEDV
ALSVIKTYGKNSMPDRALDVFQRMVEIFGCEPGIRSYNTLLNALVEAKRWVEVESLFAYLETAGVAPNLQTYNVLIKMYC
KRKQFEKARGFLDWMWKARFKPDVFSYSTVINDLAKAGKLDDALDLFDEMSERGVAPDVTCYNILIDGSLKERDHSMALK
LWNRLLEDSSVYPNVKTHNIMISGLSKCGRVDDCLKIWERMKQNEREKDLYTYSSFIHGLCGAGNVDKAESVFKELVESK
ASIDVVTYNTMLGGFCHCGKIKESLELWRIMEQKNSVNIVSYNILIKGLLEYRKIDEATMIWRLMPAKGYTPDDTTYGIF
IHGLCVNGYVNKALGVMQEVKSKGGHLDVFAYSSIVDCLCKEKRLEEAANLVKEISKQGVELNSHVCNALIGGLIRNSRL
GDASLLLREMGKNGCRPTVVSYNILIDALCKAGKFGEASTVVKEMLANGWKPDLITYSVLLDGLRHDRKIDLALELWHQF
LQSGLEPDVRMHNILIHHLCSIGKLDDAVIVMANMEHRNCIANLVTYNTLMEGFFKVRDSNRATMIWGYMYKMGLQPDII
SYNIILKGLCMCHRVSYAIEFFDDARNHGFFPTVVTWNILVRAVVNR*

DNA
ATGGTCGTGTTCCCCAAATCACTGTCACCGAAACACGTCCTCAAGCTCTTGAACTCGGAGAAGAACCCGCGCGCAGCTTT
TGCTCTATTCGATTCAGCGACTCGTCACCCAGGCTATGCACACTCCGCCGTCGTCTACCACCATATACTCCGACGTCTCT
CGGAGGCGCGGATGGTTAACCATGTAACTCGAATCGTCGAGCTCATTAGGTCACAGGGGTGCAAGTGCGACGAAGACGTC
GCTTTATCGGTTATCAAAACCTACGGAAAGAACTCCATGCCCGATCGCGCTCTGGATGTTTTCCAACGAATGGTGGAGAT
CTTCGGGTGTGAGCCTGGGATTAGATCTTATAACACTCTGCTCAATGCCTTGGTAGAAGCGAAACGATGGGTTGAAGTGG
AGTCCTTGTTCGCCTACTTGGAAACAGCGGGTGTGGCGCCAAATCTGCAGACGTATAATGTTTTGATTAAGATGTACTGT
AAGAGGAAGCAGTTCGAGAAAGCTAGAGGGTTTCTTGATTGGATGTGGAAAGCGAGGTTTAAGCCGGATGTGTTCAGTTA
CAGCACTGTGATCAACGATCTTGCGAAAGCTGGAAAACTGGATGATGCACTGGACCTGTTCGATGAAATGTCTGAAAGAG
GAGTAGCACCTGACGTTACTTGTTATAATATCTTAATTGATGGTTCTCTTAAGGAGAGGGATCACAGTATGGCTTTGAAG
CTGTGGAACAGACTGTTGGAGGACTCTTCTGTTTATCCTAATGTTAAGACTCACAACATCATGATTAGTGGTTTGAGCAA
ATGCGGAAGAGTAGATGATTGTTTGAAGATATGGGAAAGAATGAAACAGAATGAGCGAGAAAAAGATTTATATACATACA
GCAGTTTTATACATGGTCTGTGCGGTGCAGGGAATGTTGATAAGGCCGAAAGTGTGTTCAAAGAGTTGGTCGAAAGTAAG
GCCTCTATTGATGTGGTTACATACAATACTATGCTTGGTGGGTTTTGCCATTGTGGGAAAATTAAGGAGAGTTTGGAGTT
ATGGAGAATCATGGAGCAGAAGAATTCAGTTAACATAGTGAGTTATAATATTTTGATAAAAGGGTTGCTGGAGTATCGGA
AGATCGATGAAGCAACAATGATTTGGAGGCTTATGCCTGCCAAGGGCTACACACCTGACGACACAACTTATGGTATATTT
ATTCACGGGCTATGCGTGAATGGTTACGTAAATAAAGCCTTGGGGGTGATGCAAGAGGTGAAGAGCAAAGGTGGGCATCT
GGATGTTTTTGCATATTCATCAATTGTAGACTGCTTATGCAAAGAGAAAAGACTAGAAGAAGCAGCAAATTTAGTAAAAG
AGATAAGTAAGCAAGGCGTGGAGCTGAATTCTCATGTCTGTAATGCCTTAATAGGTGGTTTGATCCGAAACTCAAGACTT
GGTGATGCTTCCCTTTTGCTGAGAGAGATGGGAAAGAACGGTTGTCGGCCGACTGTTGTATCTTACAATATTCTTATTGA
TGCTTTGTGTAAAGCAGGGAAATTCGGTGAAGCATCTACTGTTGTGAAAGAAATGCTTGCAAACGGGTGGAAACCAGATC
TGATAACTTATAGTGTACTCTTGGACGGTCTTCGTCACGACAGGAAGATCGACTTAGCCCTTGAATTGTGGCACCAATTT
CTTCAATCTGGTCTAGAACCTGATGTGAGGATGCATAACATACTAATTCATCACCTGTGTTCTATTGGGAAACTTGATGA
TGCAGTGATTGTCATGGCAAATATGGAGCATAGGAATTGCATTGCAAATCTCGTTACCTACAACACTTTGATGGAAGGAT
TCTTCAAAGTTAGAGACAGCAACAGAGCCACAATGATTTGGGGTTACATGTACAAGATGGGGTTGCAGCCTGATATTATA
TCATACAATATTATACTGAAAGGGTTGTGTATGTGCCACAGAGTGTCGTACGCAATTGAATTTTTTGATGATGCTCGAAA
CCATGGCTTTTTTCCAACAGTTGTCACCTGGAACATACTTGTTCGAGCTGTCGTGAATCGCTAA