Details for Capsella Locus Carubv10015355m

Position : scaf_3 ( 5`- 852420 .. 854169 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015355m

Protein [Map View]
NPVKHKLESLLPRKCQIGIRKTYRPGAPFHLHKETLAKRSAKVTTLIDCNKLHELRWILRDMDINPSTFELVARFCYGYK
IELSSENIVSVLCIAYYLEMSDDHSSNNLLNMAVTFLEQRVLMSWNETMKALRICTERILDKLADVGLIEVFLDSLVEKA
LNDTRLLQDLITLPLRLYEPLILELSKHNVSIESLVASVCNYTKRWVFEKDSGDESFSRHKREVIEAVERLLPHERGTIS
CGFLFQSLKESIFLDACSDCRKGFEVRISSQLDMATAKDLLILFPKEDGSYDIELLKRILKIFYSNYNVSDLSRFVSIAR
MLEDFLLEAAASDAGLRVGAFKALAEITVAASCDVLRYSDGIYRAIDVFLEWHRDLIESEKMEACRVLECKKLSSEACEH
ASKNEKLPLRIVVQVLFVSQTQIRNNVAREMKDVEKKTEDQVDEDDEMEKMSKKMLSLEIEPGYSKKRKIENIECAVHCE
KKKKSVWREVKRKFGCMTSTVKACDCHNKKRKKTYRY*

DNA
AACCCCGTGAAACACAAGCTTGAAAGTCTGCTACCTCGAAAATGTCAAATAGGTATACGAAAAACTTATCGACCCGGCGC
CCCATTTCATCTTCACAAAGAGACTCTAGCTAAGAGATCGGCGAAAGTGACGACATTAATCGATTGTAACAAGCTCCATG
AACTGCGTTGGATCCTCAGAGACATGGACATCAACCCGAGTACCTTCGAACTCGTGGCTAGATTCTGCTATGGCTACAAA
ATCGAATTGTCATCTGAAAACATTGTCTCTGTGCTCTGCATTGCTTATTACTTAGAGATGAGCGATGATCATAGCTCTAA
CAATTTGTTGAATATGGCAGTAACGTTCTTGGAACAACGAGTTCTTATGAGCTGGAATGAAACCATGAAAGCTCTTCGTA
TCTGCACCGAGAGGATATTGGACAAACTAGCTGATGTTGGACTCATCGAAGTTTTCTTAGATTCTCTTGTCGAAAAGGCT
CTCAACGATACTAGGTTGCTCCAAGATTTGATTACATTGCCTCTTCGGTTATATGAACCGTTGATCTTAGAATTAAGTAA
GCACAATGTCTCGATAGAAAGTCTTGTGGCATCGGTCTGCAATTACACGAAAAGATGGGTTTTCGAGAAAGATTCAGGAG
ACGAAAGCTTTTCAAGACACAAGAGAGAAGTAATTGAAGCTGTTGAGAGGCTTTTGCCTCACGAAAGGGGAACTATCTCG
TGTGGATTTTTGTTCCAATCGCTTAAAGAATCGATTTTTCTTGATGCTTGCTCTGATTGCCGAAAAGGGTTTGAAGTTAG
GATAAGTTCGCAGCTCGACATGGCTACAGCAAAAGATCTCCTGATTCTGTTTCCAAAAGAAGATGGTTCTTATGACATCG
AGCTCTTAAAACGAATTCTCAAGATCTTCTATAGTAACTATAATGTCTCAGATCTTTCGCGGTTTGTGAGTATAGCGAGA
ATGTTGGAAGATTTTCTGTTGGAGGCAGCTGCGAGTGACGCTGGTTTAAGGGTAGGAGCATTTAAGGCGTTAGCAGAAAT
AACGGTTGCTGCGTCTTGCGATGTGCTAAGATACTCTGATGGAATATATAGAGCAATTGATGTTTTCTTGGAGTGGCATC
GAGACTTGATTGAATCGGAGAAGATGGAAGCTTGTAGAGTTCTTGAATGTAAGAAACTTTCATCCGAGGCATGTGAACAT
GCTTCAAAGAACGAGAAGCTTCCACTGCGGATTGTTGTGCAAGTTTTGTTTGTTTCTCAGACGCAGATTCGCAACAATGT
GGCTAGAGAAATGAAAGATGTAGAGAAAAAAACCGAGGATCAGGTAGATGAAGATGATGAAATGGAGAAAATGAGTAAGA
AGATGTTAAGTCTGGAGATAGAACCTGGTTACAGCAAGAAAAGAAAGATTGAGAATATTGAATGTGCTGTTCATTGCGAG
AAGAAGAAGAAAAGTGTGTGGAGAGAAGTAAAGAGGAAGTTTGGTTGTATGACTTCTACTGTGAAAGCTTGCGATTGTCA
TAACAAGAAGAGGAAGAAGACTTATCGTTACTAA