Details for Capsella Locus Carubv10015353m

Position : scaf_3 ( 5`- 4037235 .. 4037750 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015353m

Protein [Map View]
MSSLRRALLVAGKTRINLENCHFITGINYNGLSVKQLQELRGILRENTNTKLLVAKNTLVYKALEGTKWESLKPCMKGMN
AWLFVQSEDIPAALKTFINFQKEKKLFDNNLGGAVFEEKLYAPQDYKVIETMPSRSDVYGMMLSSLHWPALDLVNTLQEP
TPTATENETVA*

DNA
ATGTCTAGCCTGAGAAGAGCCCTGCTCGTTGCAGGGAAGACGAGGATCAACCTCGAGAACTGCCATTTCATCACGGGAAT
CAACTACAACGGACTGAGCGTGAAGCAATTACAAGAGCTCCGTGGGATCCTCCGTGAAAACACAAACACGAAGCTCCTCG
TGGCCAAGAACACCTTGGTGTACAAAGCCTTAGAAGGAACCAAATGGGAATCTCTGAAGCCATGTATGAAGGGTATGAAC
GCTTGGCTCTTCGTTCAGTCTGAAGATATCCCTGCTGCGTTGAAGACCTTCATCAATTTCCAGAAAGAGAAGAAGCTCTT
CGATAACAACTTAGGCGGTGCCGTTTTCGAGGAGAAATTGTACGCTCCCCAAGATTACAAGGTCATTGAGACTATGCCAT
CTCGCTCCGATGTTTATGGTATGATGCTCAGTTCTTTGCATTGGCCGGCTTTAGATCTCGTCAATACGCTGCAGGAACCT
ACACCAACGGCGACAGAGAATGAGACTGTTGCTTAG