Details for Capsella Locus Carubv10015337m

Position : scaf_3 ( 5`- 1561057 .. 1563042 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015337m

Protein [Map View]
MNSRWVIQKLSSHLPSCLSTVLSPSKILIRQSPRYQVSTFLLNHVDLSHLLSICGREGWFPHLGPCLHASIVKNPEFFEP
VDADIHRNALVVWNSLLSQYVKCAKLVDALKLFDEMPIRDVISQNILFYGFLRNRETDSGFVLLKQMLGSGGFDQATLTI
VLSVCDKPKFCLVTKMIHALAVLSGYDKEISVGNKLITSYFKCGCSVSAKQVFNEMEHRNVITWTAVISGLIENELNEDG
LRLFSLMRRGLVHPNSVTYLSALAACSGSQRIVEGKQIHALLWKFGIESELCIESALMDMYSKCGSIEDAWKIFESTEEV
DEVSMTVILVGLAQNGSEEEAIQFFIRMLQAGVEIDANVVSAVLGVSFIDNSLGLGKQLHNLVIKRKFSGNAFVNNGLIN
MYSKCGDLNDSLTVFRRMPKRNYVSWNSMIAAFARHGHGLAALNLYEEMITQDVKPTDVTFLSLLHACSHVGLIDTGREL
LNVMQDVHGIEPRTEHYACIIDMFGRAGLMKEAKSFIDSLPMKPDCIIWQALLGACSFHGETEVGQYAAEQLIQSAPDSS
AAHILMANIYSARGKWKERAKTIKRMKAMGVTKETGISSIEIENKTHSFVVMDKLHPQAEAIYDVLAELFPVMIDEGYRP
GKRFILSYTGDDRNGPSFLVP*

DNA
ATGAATTCGAGATGGGTGATTCAGAAACTGAGCTCTCACCTTCCTTCTTGCTTGTCTACCGTTTTGTCCCCTTCGAAAAT
CCTAATCCGGCAAAGTCCAAGATATCAAGTCTCCACTTTTCTCCTTAATCATGTCGATCTGAGCCATCTCTTATCCATCT
GTGGAAGAGAAGGCTGGTTTCCTCATCTGGGTCCTTGTCTTCACGCCTCCATTGTCAAAAATCCTGAATTTTTCGAGCCT
GTAGATGCTGACATCCATCGAAACGCTCTTGTTGTTTGGAACTCTTTGCTTTCTCAGTATGTGAAATGTGCCAAGTTAGT
TGATGCGCTTAAGTTGTTCGACGAAATGCCCATAAGAGATGTTATTTCCCAGAATATACTGTTTTATGGGTTTCTGAGGA
ACAGAGAGACCGACTCTGGTTTTGTATTGCTTAAACAAATGCTTGGGTCTGGTGGGTTTGATCAAGCGACCTTGACGATT
GTTTTATCAGTGTGTGATAAGCCAAAATTCTGTTTGGTGACCAAGATGATTCACGCTTTAGCAGTTTTAAGCGGTTATGA
CAAGGAAATATCTGTTGGGAACAAATTGATCACATCCTATTTCAAATGTGGGTGTTCGGTTTCTGCGAAACAGGTTTTTA
ATGAGATGGAACATAGAAATGTCATCACATGGACAGCTGTGATTTCGGGTCTGATAGAGAACGAGTTAAATGAAGATGGT
CTAAGACTGTTTAGTTTGATGCGTAGAGGACTGGTCCATCCAAACTCAGTAACTTATTTGAGTGCTCTAGCTGCTTGTTC
AGGCTCGCAGAGGATAGTGGAAGGGAAACAGATTCATGCCCTTTTGTGGAAATTTGGGATTGAATCAGAATTATGCATTG
AGAGTGCGCTAATGGATATGTACTCTAAATGTGGAAGCATTGAAGATGCGTGGAAGATTTTTGAGTCCACTGAAGAAGTT
GATGAAGTTTCCATGACTGTGATATTAGTTGGTTTAGCACAAAATGGGTCAGAAGAAGAAGCTATACAGTTCTTCATTAG
AATGCTTCAAGCTGGTGTAGAGATTGATGCAAATGTAGTCTCAGCTGTTCTTGGAGTTTCGTTTATTGATAATTCTTTAG
GTCTAGGCAAGCAACTGCATAATTTAGTCATCAAACGAAAATTCTCCGGTAACGCCTTTGTCAACAATGGACTCATTAAT
ATGTACTCAAAATGTGGAGACCTGAATGATTCACTAACTGTCTTTAGACGAATGCCTAAGCGGAACTATGTTTCTTGGAA
CTCGATGATTGCAGCATTTGCTCGCCATGGTCATGGATTAGCTGCCTTGAATCTATACGAAGAAATGATTACACAAGACG
TGAAGCCTACAGATGTTACCTTTCTATCACTACTTCATGCTTGTAGCCATGTAGGGTTGATCGATACAGGCCGAGAACTC
TTAAATGTGATGCAAGATGTCCATGGAATCGAGCCTAGGACAGAGCATTATGCATGTATTATTGACATGTTTGGTCGTGC
TGGTCTTATGAAAGAAGCAAAGAGCTTTATAGACTCATTGCCTATGAAACCTGACTGTATAATTTGGCAAGCATTGCTTG
GAGCTTGTAGTTTCCATGGTGAAACAGAAGTAGGGCAATATGCAGCTGAGCAGTTAATTCAATCTGCACCTGATAGCTCA
GCAGCCCATATCTTGATGGCTAACATTTACTCAGCCAGAGGGAAATGGAAGGAGAGGGCAAAGACGATCAAGAGAATGAA
AGCAATGGGAGTGACTAAAGAAACAGGCATAAGTTCGATCGAAATTGAGAATAAAACACACAGCTTTGTGGTTATGGACA
AATTACATCCACAAGCAGAGGCTATATATGATGTTCTGGCTGAATTGTTTCCAGTTATGATAGATGAAGGTTACAGACCT
GGTAAGAGGTTTATTCTCAGTTATACAGGAGATGACAGAAACGGCCCAAGTTTCTTAGTTCCTTAA