Details for Capsella Locus Carubv10015336m

Position : scaf_3 ( 5`- 13552418 .. 13553350 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015336m

Protein [Map View]
MAMEDQSAARSTGKVNWFSDGKGYGFITPDDGGDELFVHQSSIVSDGFRSLTVGESVEYAITLGSDGKTKAIDVTAPGGG
SLNKKENSSRGSGGSCFNCGEIGHMAKDCADGGGGRSFGGGAVRRSGGGEGECYKCGDVGHFARDCRQSGGGNSGGGGGG
GGGPCYSCGEVGHLAKDCRGGSGGNRYGGGGGGGRGSGGDECYLCGGVGHFARDCRQNGGEIFGGGGGGGNTCYTCGGVG
HIARVCTSKKPSGGGGGAGSCYECGVTGHLARDCDRRGGSSGGGRGGGGSSNCFKCGKGGHFARECSSVA*

DNA
ATGGCGATGGAAGATCAATCGGCGGCGAGATCTACCGGAAAGGTTAACTGGTTTAGCGATGGGAAAGGCTATGGTTTTAT
TACTCCTGATGATGGCGGCGATGAGCTTTTTGTTCATCAATCTTCAATTGTCTCTGATGGTTTCCGTAGCTTGACTGTTG
GTGAATCAGTTGAGTACGCAATCACGCTTGGAAGCGATGGGAAGACTAAGGCCATTGATGTCACTGCTCCCGGCGGCGGT
TCTCTTAACAAGAAGGAGAATAGTTCCCGTGGAAGCGGCGGTAGTTGTTTTAATTGCGGTGAGATTGGTCATATGGCTAA
GGATTGTGCCGATGGCGGTGGTGGGAGAAGCTTTGGAGGTGGTGCTGTTCGTAGATCTGGCGGCGGAGAAGGTGAATGTT
ACAAATGTGGTGATGTGGGGCACTTTGCTAGGGATTGTAGGCAGAGCGGTGGTGGAAACAGTGGAGGCGGCGGCGGCGGT
GGTGGCGGTCCGTGTTACAGTTGCGGAGAGGTTGGTCATTTGGCAAAGGATTGTCGTGGTGGATCCGGTGGAAATAGGTA
TGGAGGTGGTGGTGGTGGTGGTCGTGGATCCGGCGGTGATGAATGCTACTTGTGTGGTGGTGTGGGACATTTCGCTAGGG
ATTGTAGGCAAAACGGTGGTGAAATCTTTGGTGGTGGCGGTGGTGGTGGAAACACTTGCTATACCTGTGGCGGAGTTGGC
CATATTGCTAGAGTCTGCACCAGCAAGAAACCTTCTGGTGGTGGTGGTGGTGCTGGTTCTTGTTACGAATGTGGAGTAAC
TGGCCATTTGGCTCGTGACTGTGATCGTAGAGGAGGAAGCAGCGGCGGTGGTCGTGGAGGCGGTGGCAGTAGCAACTGCT
TCAAGTGCGGCAAGGGAGGTCACTTTGCAAGGGAATGTTCTTCGGTTGCTTAA