Details for Capsella Locus Carubv10015331m

Position : scaf_3 ( 5`- 5248363 .. 5249013 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015331m

Protein [Map View]
MVNHRKTTDADEPSPEFEFGSLTPSSPSQDSFNENSPADHLFFNGRLLPHSFPAASSMYTKRSISSTSATSAFTSRSNST
NSRSSFGSSSNSTSHSPRTSMSCNNNMSHPITHNKTLDTKPLNSRCGKTVNSTSRKATEMVTASLYRSYSSQRWQYITPV
PVKMSGGIRVGGRKKKVPRVRKKTEERRGSRVMKLWRRILMAAIFACRECHAFDGA*

DNA
ATGGTGAATCATCGGAAAACCACAGACGCTGACGAGCCGTCACCGGAGTTTGAGTTCGGATCGTTGACTCCATCTTCTCC
GTCGCAAGACTCGTTCAATGAGAATTCTCCCGCCGATCACCTCTTCTTTAACGGGCGTCTCTTGCCACACTCTTTCCCTG
CGGCGAGCAGTATGTATACAAAGCGGTCAATCTCGAGTACGAGTGCGACCAGCGCATTCACCTCCCGGAGCAACAGTACG
AACAGTAGGAGTAGTTTTGGTAGTAGTAGCAACTCAACTTCTCATTCTCCGAGAACGAGCATGAGTTGCAACAACAACAT
GAGTCATCCCATTACTCACAACAAGACGTTGGATACAAAACCTCTGAATAGTAGATGTGGCAAAACCGTGAATTCAACAA
GTAGGAAAGCGACGGAGATGGTGACAGCGTCTCTGTACAGGTCGTATTCATCGCAGCGGTGGCAATATATAACTCCGGTG
CCGGTGAAAATGAGTGGAGGGATAAGGGTCGGTGGGCGGAAGAAGAAGGTGCCGAGGGTGAGGAAGAAGACTGAAGAGAG
AAGAGGGAGTAGAGTGATGAAGCTGTGGAGAAGAATACTAATGGCGGCGATTTTTGCTTGTAGAGAGTGCCATGCATTTG
ATGGAGCTTGA