Details for Capsella Locus Carubv10015330m

Position : scaf_3 ( 5`- 2970338 .. 2971771 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015330m

Protein [Map View]
MPLAISLPTSSFSNLFPHRRGHATLRYRRFSGARSSAEGPYNQKNQTGVIIIGAGLAGLAAATRLTSERIPFLLLEASDG
VGGRVRTDIVDGFFLDRGFQIFISAYPEAKKLLDYEALDLQRFYAGAKVFYGGKFHTVADPLRHFWDSVASLTNPIGSVV
DKGLIALTRARVLIKSDQEILTAADEVPTIDLLRKIGFSEAILDRFFRPFFGGIFFDRDLGTTSKLFDFIFRCLALGENT
LPAMGIGEIPNQLAAKLPANSVLFNTRVASIEYPTGSDSDPPSVRLQDGGVLKADLGVIVAVEQHQADKLLEGIREPVPT
KPARSTICVYFTADPNQIPVQDPVLFLNGSSTGIINNMFFSTNVARTYAPPGKALVSVSLIGSFEDRSDDDLATEVLREL
SGWFSESSVMSWKHLKTYRIKFAQPNQCPPTDLVKSPRVRTGLYLCGDYMTSATFDGALVSGRRAVEVLLREKGLIT*

DNA
ATGCCACTGGCGATCTCTCTCCCAACCTCATCTTTTTCTAATCTCTTCCCTCACCGCCGCGGCCATGCAACTCTCCGATA
TCGACGCTTTTCTGGAGCTCGATCTTCCGCCGAAGGGCCGTACAACCAAAAGAACCAAACCGGCGTCATCATCATCGGCG
CTGGACTCGCTGGTTTAGCCGCCGCAACTCGGCTAACCTCCGAACGAATCCCATTCCTACTCTTAGAAGCTTCTGACGGC
GTCGGTGGACGCGTCCGTACAGACATCGTCGACGGCTTCTTCCTCGACAGAGGGTTTCAGATTTTCATCTCTGCATATCC
CGAAGCTAAAAAGCTTCTAGATTATGAAGCACTGGATCTGCAGCGATTCTACGCCGGAGCAAAGGTTTTTTACGGCGGAA
AATTTCACACCGTAGCTGATCCTCTCCGACATTTTTGGGATTCGGTGGCTTCTCTCACGAACCCCATCGGATCCGTCGTG
GACAAAGGGCTTATCGCGTTGACGAGAGCTAGAGTTCTGATCAAGTCAGACCAAGAGATTTTGACTGCCGCCGATGAGGT
TCCGACCATTGATCTCCTCCGTAAGATTGGTTTCTCCGAAGCGATCCTTGATCGATTCTTCCGACCATTCTTCGGCGGAA
TTTTCTTCGACAGAGACCTCGGGACGACTTCGAAGCTCTTCGATTTCATTTTCCGGTGTCTTGCTCTCGGAGAAAACACA
CTTCCGGCCATGGGAATCGGAGAAATCCCTAACCAATTGGCCGCGAAATTACCAGCTAATTCCGTCTTGTTCAACACAAG
GGTCGCTTCGATTGAGTATCCAACTGGATCGGATTCGGATCCTCCTAGCGTGAGACTCCAAGACGGTGGCGTTTTGAAGG
CTGACTTAGGTGTCATAGTCGCCGTCGAGCAACACCAAGCGGATAAGCTTCTTGAGGGGATCAGAGAACCGGTTCCAACT
AAACCGGCTCGGAGTACGATTTGCGTTTATTTCACAGCTGACCCGAATCAGATACCGGTACAAGACCCGGTTCTATTTCT
CAACGGGTCAAGCACCGGTATAATCAACAACATGTTCTTCTCTACGAACGTTGCTCGGACATACGCGCCACCGGGAAAGG
CTCTGGTTTCGGTATCGTTGATCGGTTCGTTCGAGGATAGATCCGATGATGATTTAGCAACAGAGGTTCTCAGAGAACTC
TCTGGTTGGTTCAGTGAGTCTTCGGTTATGTCATGGAAACATTTGAAAACGTACCGAATAAAGTTCGCTCAGCCGAACCA
ATGCCCACCCACTGATTTGGTTAAGAGTCCGCGGGTCAGGACAGGTCTTTACTTGTGCGGTGATTACATGACTTCTGCTA
CATTTGACGGGGCTTTGGTCTCCGGGAGACGAGCCGTGGAAGTGTTGTTACGAGAAAAGGGACTAATCACATAG