Details for Capsella Locus Carubv10015327m

Position : scaf_3 ( 5`- 3656638 .. 3661655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015327m

Protein [Map View]
MHKEVPPPPSTLGFGRFKKRNGKYIDKEEVAPSPPPPPPLPSFGHGKYQNRSGKKMDSEEVVPPPPPPPPPPTSGYGRAY
NRNIKKMDKEEVSPPRQQNEPPPLPKENPRCPVSHPDRPHTLCPRLGGNTDSGCFSCGEKTSPLIEDHNYHFFCQTCDEE
FHRVCHMFPRNLTHPYHLQHPLTFTFRNYETGCVADGNIDESFCATVLSGSNMSHPKKLGSIEPDQCTWCRKIIQCNWFY
RCSLCNFCLDLHCSQNIPPLLVANPKNHQHQLVFYRRPLLTPCDACGLVNVLDPSYACFECNYMIHQSCIELPRVIKITR
HQHRLFHTPCLQSKISPCRICYETVDTKYGQYSCNHEKCSYIVHSNCATNENVWDGKELEQEPEEQDEIEDILPYKKVWG
NLIKHFSHEHLLKLKKYDGVIDVEKQCQACILPIDSRDFYNCTHCAFFLHEVCANLLRKMSHALHKHPLSLATSPQNRYD
LINCSACSRKSTGFRYICTKKNCVSKHVQIDVRCISSVPDYFTHESHEHPLFISTSSKGGNKTGCVGCKKIGMRSYLQCT
KCKFAMCYLCATIPTKVSYKYDKHPLYLSYGEKSDDTYWCEVCEKKVNPRDRFYKCNECCITIHLHCIFGSSAYMKPGFR
FKYNSSKVEVRRNSNITRPYCVECGHRCPGYIYYKNDNSVTVTCSLEREREMDWDSVAAEDVIEALREVEWSTRPRSLAE
FFSRFAFPRSFSKWMSRLKCNLYYYRTNYFILLIFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHF
SPHLAAKMRPPHMPVIRGRSASRKAVYVCGQPRLVFVLIGLTASFVLWFMSCGLLWVLYAFTTALLLILLHASLRTPNLK
ARLNTFREEFRAVWRNYSEL*

DNA
ATGCACAAAGAAGTACCTCCACCTCCCTCAACTCTTGGATTTGGACGATTTAAAAAGAGAAACGGCAAATATATCGACAA
AGAAGAAGTTGCTCCATCACCTCCACCGCCTCCACCTCTTCCATCTTTTGGACATGGAAAATATCAAAACCGAAGTGGCA
AAAAGATGGACAGCGAAGAAGTTGTTCCACCTCCTCCACCCCCTCCGCCTCCTCCAACTTCTGGATATGGACGAGCTTAT
AACCGAAACATCAAAAAGATGGACAAAGAAGAAGTATCTCCACCTCGACAACAAAATGAGCCTCCCCCTCTTCCTAAAGA
AAACCCAAGATGTCCTGTGTCTCATCCAGATCGCCCTCACACACTTTGTCCTAGACTCGGCGGAAACACCGACTCTGGTT
GTTTTTCATGCGGCGAAAAGACATCTCCCTTGATCGAAGACCACAACTATCATTTCTTCTGCCAGACTTGCGATGAGGAG
TTCCACAGAGTTTGTCATATGTTTCCAAGGAATTTAACACATCCTTATCACCTCCAACACCCTCTTACTTTCACCTTCCG
GAACTATGAAACCGGGTGCGTAGCAGACGGTAATATAGATGAGTCTTTCTGCGCTACAGTTTTGTCTGGCTCCAACATGT
CTCATCCTAAGAAGTTGGGATCTATCGAACCTGATCAATGCACATGGTGTAGAAAAATTATCCAATGCAATTGGTTCTAC
CGTTGCTCTCTATGCAACTTTTGTTTGGATCTCCATTGCTCCCAAAATATTCCACCTCTCCTTGTTGCAAACCCGAAGAA
TCATCAACATCAACTCGTCTTCTACAGGCGACCTCTCTTGACTCCATGTGATGCTTGTGGATTGGTCAATGTGTTGGATC
CAAGCTATGCTTGTTTTGAATGTAACTACATGATCCATCAAAGTTGCATCGAGCTACCACGAGTCATAAAGATCACGCGT
CACCAGCATCGCCTTTTTCACACTCCTTGCCTCCAATCGAAGATTTCACCATGTCGGATATGCTACGAGACAGTTGACAC
CAAGTACGGCCAATATTCTTGCAACCACGAGAAATGCTCTTATATAGTTCATTCAAATTGTGCAACAAATGAGAACGTAT
GGGACGGGAAAGAACTCGAACAGGAACCCGAAGAACAAGACGAGATTGAAGATATCCTCCCATATAAGAAGGTTTGGGGT
AACCTAATAAAACATTTCTCTCATGAACATCTTCTAAAGCTCAAGAAGTATGATGGTGTAATAGATGTAGAGAAGCAATG
TCAAGCATGCATCCTTCCTATCGACTCTCGTGATTTCTACAATTGCACGCACTGTGCTTTTTTTCTCCACGAGGTATGTG
CTAACCTTCTTCGGAAAATGAGTCATGCGTTACACAAACACCCTCTTTCCCTAGCCACCTCTCCTCAAAACCGCTATGAT
CTCATCAATTGTTCAGCTTGTTCCAGAAAGTCCACTGGTTTCAGGTACATATGTACCAAAAAGAACTGTGTGTCCAAGCA
CGTTCAGATAGATGTTCGATGTATTTCGTCAGTTCCTGATTATTTCACCCATGAAAGTCATGAACATCCTCTGTTTATCT
CCACATCTTCTAAAGGTGGAAACAAGACTGGTTGCGTGGGTTGCAAGAAGATAGGTATGCGGTCTTACCTACAGTGTACT
AAATGCAAATTTGCTATGTGTTATCTATGCGCTACAATTCCAACTAAAGTAAGCTACAAATACGACAAGCATCCTCTTTA
TCTAAGCTATGGAGAAAAATCAGATGATACGTACTGGTGCGAAGTATGTGAGAAAAAGGTAAATCCAAGGGATAGGTTCT
ACAAATGCAACGAATGTTGTATCACTATCCACCTTCACTGCATATTCGGATCTTCTGCTTATATGAAGCCTGGTTTCAGA
TTCAAGTATAACTCGTCGAAAGTGGAAGTTCGCCGCAACAGCAACATCACTAGACCTTATTGCGTTGAATGTGGTCATCG
TTGTCCAGGTTACATCTACTACAAAAACGATAACTCTGTAACTGTTACTTGTTCTTTAGAGAGAGAGAGAGAGATGGATT
GGGATAGCGTTGCTGCTGAGGATGTGATTGAGGCGCTAAGAGAGGTTGAATGGTCGACGCGTCCTCGTTCCTTGGCTGAG
TTTTTCTCCAGATTCGCTTTTCCTCGATCTTTCTCTAAATGGATGAGCCGTCTCAAATGCAATCTCTACTACTATAGGAC
GAATTACTTCATCCTGTTGATTTTCGTTCTGGGTCTTGCACTTATAACGCGACCTTTGGCCATTCTTGGTGCTGCTCTTA
CTGCCTTAAGCTTAGCTTTCCTAAACGACAGTTTTGCAGCTACTTTTAATGAGAAGATGATCCGGACCATTAGGCATTTC
TCTCCACATTTAGCTGCAAAGATGAGGCCTCCCCACATGCCTGTCATTCGTGGGCGATCTGCAAGTAGAAAGGCAGTCTA
TGTTTGTGGCCAACCCCGTTTGGTATTCGTCTTGATTGGCTTAACTGCCAGTTTTGTCCTGTGGTTTATGTCCTGCGGTT
TGTTATGGGTCCTCTATGCATTTACCACTGCCCTTCTCTTGATCCTTCTTCACGCAAGCCTGAGAACTCCAAACCTCAAG
GCACGCTTGAACACATTCCGTGAAGAATTCCGGGCTGTCTGGCGCAACTACAGTGAACTTTAA