Details for Capsella Locus Carubv10015323m

Position : scaf_3 ( 5`- 5055508 .. 5057481 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015323m

Protein [Map View]
MTVLFMRIEIQFFSAGALRFLPRNRDHFSAIKLSSALASLYSTVSGRIEEHQKRYEYHNVATCIATLQRCAQRNDSGTGQ
KIHGFMVRKGFLEDSPRAVTSLVNMYAKCGLMRRAVTVFDGSERDVFGYNALISGFVVNGSPFDAMEMYREMRAKGILPD
KYTFPSLLKGCDAMELSDVQKVHGLAFKLGLDSDCYVGSGLVTSYSKFMSVEDAQKVFDELPDRDDSVLWNALVNGYSQI
FRFEDALTVFSKMREEGVGMSRHTITSVLSGFTVSGDLDNGRSVHGLAVKMGSDSDIVVSNALIDMYGKSKKLEKATRIF
EAMDERDIFTWNSILCVNDYCGDHDGTLALFKNMLRSGIRPDIVTLTTVLPTYGRLAALDQGREIHGYMTVSGLQNRNSS
NQFFIHNSLMDMYVKCGDLRDARMIFDLMRVKDSASWNIMINGYGVQSCGELALDMFSCMCRAGVKPDEITFVGLLQACS
HSGFVDEGRSFFAQMETVYNIPPTSDHYTCVIDMLGRANKLEEAYELAVSMPICDNPVVWRSILSSCRLHGNTDLALVAG
KRLYELEPEHCGGYVLMSNVYVKAGKYMEVLDVRDTMRQQNVKKTPGCSWIGLKTGVHTFFTGDKTHPELKSIHAWLNQL
ISHMHGHESMMLDRLFG*

DNA
ATGACCGTTTTGTTTATGCGGATCGAGATTCAATTTTTTTCTGCCGGAGCTCTGAGGTTTCTCCCGCGGAACCGAGATCA
CTTCTCAGCAATAAAGCTTTCTTCTGCGTTAGCATCTTTATATTCGACAGTTTCTGGGCGAATCGAAGAACACCAAAAGA
GATACGAGTACCACAATGTTGCTACATGTATCGCTACGTTGCAACGCTGTGCGCAGCGCAATGATTCGGGAACCGGGCAA
AAGATCCACGGTTTCATGGTTAGGAAAGGGTTTCTCGAAGATTCGCCTCGCGCTGTCACGAGCCTCGTCAACATGTACGC
TAAGTGTGGTCTTATGCGGCGCGCGGTGACGGTCTTCGACGGATCTGAACGCGATGTGTTTGGTTATAACGCTTTGATTT
CTGGGTTTGTGGTGAATGGGTCTCCTTTTGATGCGATGGAGATGTATAGAGAAATGCGAGCTAAAGGGATTTTGCCTGAT
AAGTATACATTTCCTAGTTTGCTTAAAGGATGCGATGCTATGGAGCTTTCTGATGTTCAGAAGGTTCATGGATTAGCGTT
TAAACTTGGGCTTGATTCCGATTGTTATGTGGGGAGTGGTTTAGTTACTTCTTATTCGAAGTTCATGTCAGTGGAGGATG
CTCAGAAAGTGTTCGATGAATTGCCTGACAGAGATGACAGTGTGCTTTGGAATGCTTTGGTCAATGGGTATTCACAGATA
TTTAGATTTGAGGATGCTTTGACAGTCTTTAGTAAGATGCGTGAAGAAGGTGTAGGCATGAGTAGGCATACCATTACAAG
TGTCTTATCGGGGTTTACTGTATCAGGGGATCTTGACAACGGCAGGTCAGTCCATGGTCTTGCGGTGAAAATGGGATCTG
ATTCTGATATTGTTGTGTCAAATGCATTGATTGATATGTATGGAAAGAGTAAGAAGCTAGAAAAGGCTACCCGTATATTC
GAAGCAATGGATGAGAGAGACATATTTACTTGGAACTCTATCTTATGTGTAAATGACTACTGTGGTGATCATGATGGAAC
CTTAGCTCTTTTCAAAAACATGCTTCGTTCTGGAATCCGACCTGATATTGTTACATTGACAACTGTTCTGCCCACTTACG
GTCGTCTAGCTGCACTGGATCAGGGCAGAGAGATTCATGGCTACATGACCGTCAGTGGACTTCAAAACCGCAATTCCAGT
AATCAGTTCTTCATACATAACTCTTTGATGGATATGTACGTGAAATGCGGGGACTTGAGGGACGCTCGAATGATTTTTGA
CTTGATGAGGGTTAAAGACTCAGCTTCCTGGAATATCATGATCAATGGTTACGGTGTGCAGAGCTGCGGTGAGTTAGCTT
TGGATATGTTTTCATGTATGTGCAGAGCCGGTGTCAAACCCGATGAAATCACATTCGTTGGGTTGCTACAAGCATGTAGC
CACTCCGGCTTTGTGGACGAAGGGAGAAGTTTTTTTGCACAGATGGAGACGGTATATAACATTCCCCCAACAAGTGATCA
CTACACTTGTGTAATAGACATGCTTGGCCGTGCAAACAAGCTAGAGGAAGCATATGAGTTAGCAGTATCAATGCCCATTT
GCGATAATCCTGTAGTCTGGAGGTCCATATTGTCATCTTGTCGTCTTCACGGGAACACAGATCTCGCACTGGTGGCAGGA
AAGCGGCTATATGAGCTCGAGCCAGAGCATTGCGGTGGCTATGTATTAATGTCTAATGTTTATGTGAAAGCTGGGAAGTA
CATGGAAGTGTTGGACGTTAGAGACACAATGAGACAGCAGAATGTGAAAAAGACTCCAGGTTGCAGCTGGATTGGGCTCA
AGACCGGTGTTCACACGTTTTTTACCGGCGATAAGACTCACCCAGAATTGAAATCTATACACGCTTGGTTAAACCAATTG
ATTTCCCATATGCATGGTCATGAGTCGATGATGCTCGACCGCTTATTTGGGTAG