Details for Capsella Locus Carubv10015320m

Position : scaf_3 ( 5`- 1563321 .. 1567355 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015320m

Protein [Map View]
MIPLTLSSPSLNRLVLLSSRYSHSPFLRNFKSLPLSHRKLPYIPPFGVRCHVSSSSSSSFTAKSSKEIRKAQTKVVVDEK
LSSIRRVFSDPGVGIDAYIVPSQDAHQSEFIAECYARRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLNSSWIL
MRAGNPGVPSASEWVADVLAPGGRVGIDPFLFSADAAEELKEVIAKKNHELVYLYNVNLVDEIWKDSRPKPPSKQIRIHD
LKHAGIDVASKLLSLRNQIMDAGASAIVISMLDEIAWVLNLRGSDVPHSPVMYAYLIVEVDQAQLFVNNSKVTAEVKDHL
KNAGIEVRPYDSILQEIDSLAGRGAQLLMDPSTLNVAIISTYKSACERYSRKSESEGKPKTKFTDSSSGDIPNSSGIYMQ
SPISWAKAIKNDAELQGMKNSHLRDAAALAHFWAWLEKEVHTNANLTEVDVADRLLEFRSLQDGFMDTSFDTISGSGANG
AIIHYKPEPESCSRVDPQKLFLLDSGAQYVDGTTDITRTVHFSEPSAREKECFTRVLQGHIALDQAVFPEGTPGFVLDGF
ARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLQNGMIVSNEPGYYEDHAFGIRIENLLHVKDAETPNRF
GGATYLGFEKLTFFPIQLKMVDVSLLSDTEIEWLNSYHTEVWEKVSPLLEGSTTQQWLWNNTRPLAKP*

DNA
ATGATTCCTCTAACTCTTTCTTCGCCGTCTCTGAATCGGCTCGTTTTGCTCTCCTCACGTTACTCTCACTCTCCCTTTCT
CCGAAACTTCAAATCTCTCCCTTTGAGCCACCGGAAATTACCGTACATACCTCCTTTTGGCGTAAGGTGCCATGTCAGTA
GCAGCAGTTCTTCGTCCTTCACGGCAAAGTCTTCTAAAGAGATTCGTAAAGCTCAAACCAAAGTAGTCGTTGACGAGAAG
CTTAGCTCAATCCGGCGGGTGTTTTCTGATCCGGGTGTTGGAATCGATGCTTATATCGTACCTTCACAAGATGCACATCA
GAGCGAGTTCATCGCAGAGTGCTATGCGAGGAGGGCTTATATATCAGGATTTACTGGAAGTGCTGGTACCGCTGTTGTCA
CTAAGGATAAGGCAGCTCTATGGACAGATGGCCGCTATTTTCTTCAGGCGGAGAAGCAATTAAACTCTAGTTGGATTCTC
ATGCGGGCTGGTAATCCGGGAGTCCCTTCGGCAAGTGAATGGGTAGCTGATGTTTTGGCTCCTGGTGGAAGAGTTGGTAT
TGACCCTTTCCTTTTTTCCGCTGATGCTGCTGAGGAATTGAAGGAGGTTATAGCAAAGAAGAATCATGAGTTGGTTTACT
TGTACAATGTAAACCTTGTGGATGAGATATGGAAGGACTCAAGGCCAAAGCCTCCAAGCAAACAAATAAGGATACATGAC
TTGAAGCATGCTGGTATAGATGTGGCCTCAAAATTGTTGTCTCTGAGGAATCAAATTATGGATGCTGGCGCATCTGCCAT
TGTGATATCCATGCTTGATGAGATTGCATGGGTGCTAAATCTGAGAGGGAGCGATGTTCCACATTCACCTGTAATGTATG
CATATCTGATTGTAGAGGTTGACCAAGCCCAACTCTTCGTGAATAATTCTAAAGTAACGGCAGAGGTGAAAGATCATTTG
AAAAACGCAGGGATAGAAGTTAGACCTTACGATTCCATTCTTCAAGAAATAGATAGTCTGGCAGGACGTGGGGCTCAGCT
CTTGATGGATCCTTCAACCCTCAACGTAGCAATCATTAGTACGTACAAATCTGCGTGTGAAAGATATTCGAGAAAATCTG
AAAGCGAGGGAAAACCTAAGACAAAGTTTACTGATAGCTCCAGCGGAGATATACCGAATTCCTCTGGCATTTACATGCAA
TCTCCTATTTCTTGGGCAAAAGCCATTAAAAATGATGCCGAGCTACAGGGAATGAAGAACTCTCACTTGAGAGATGCTGC
TGCTCTAGCTCATTTCTGGGCTTGGCTGGAAAAAGAAGTGCATACTAATGCGAACCTAACAGAGGTCGATGTGGCAGACA
GGCTTCTTGAATTTCGTTCACTGCAAGATGGATTTATGGATACAAGCTTTGATACAATAAGTGGTTCCGGTGCAAATGGT
GCTATTATACATTATAAACCCGAGCCAGAGAGCTGCAGTCGCGTAGACCCTCAAAAACTTTTCTTGCTGGATAGTGGCGC
TCAATATGTTGATGGAACAACAGACATCACTAGAACAGTACATTTTAGTGAACCTTCTGCCCGAGAGAAAGAATGTTTCA
CTCGAGTTTTGCAGGGTCATATAGCTCTTGATCAAGCAGTGTTCCCAGAAGGTACTCCTGGTTTTGTATTGGATGGGTTT
GCACGCTCTTCTCTCTGGAAAATTGGACTTGATTACCGCCATGGGACAGGACACGGCGTAGGTGCTGCACTCAATGTGCA
TGAAGGTCCTCAAAGTATTAGCTTTCGGTATGGAAACATGACCCCTCTTCAGAATGGCATGATAGTAAGCAACGAACCTG
GATATTATGAAGACCATGCATTTGGAATCCGAATTGAGAATCTCCTTCATGTGAAAGATGCTGAAACACCAAACCGCTTT
GGTGGGGCTACATACCTTGGATTTGAGAAGCTTACATTCTTCCCTATTCAGTTAAAAATGGTTGATGTTTCTTTGCTATC
TGATACTGAGATTGAATGGCTTAATAGTTACCACACGGAAGTCTGGGAAAAGGTCTCACCATTATTGGAAGGTTCTACTA
CTCAGCAGTGGCTCTGGAACAACACAAGACCGTTAGCCAAACCGTGA