Details for Capsella Locus Carubv10015310m

Position : scaf_3 ( 5`- 5058613 .. 5059720 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015310m

Protein [Map View]
MDAQYQDLPPLKRYRMMQRDLEAAQQNLPEAKPSQLPAKKRKQARVDYDDDGENSNPTYRCLPAKKRIWAIDPDLLSVSG
NPFSPFDLNVEYKPSVEEKSVAKKSTLMVESSLELEDDDKENIDPLGNGKVLDLEDRKVEDEDGTMCAVCQSTDGEPSNP
IVFCDGCDLMVHASCYGNPLVKAIPEGDWFCSQCISSNNREKLLSCCLCTTKGGAMKPTNDGRWAHITCALFVPEVYFED
PEGREGICCSEVPSKRWKDRCYLCKSRRGCVIKCSEMRCQLDFHVTCGLKEDLCIEYREDKKTGGIVVGFCNDHTKLWER
ESGKYKIVARDEDKK*

DNA
ATGGATGCTCAGTATCAAGATCTACCTCCTCTCAAAAGATATAGAATGATGCAGCGAGACCTTGAAGCTGCTCAACAGAA
CCTACCGGAGGCGAAGCCGTCACAGTTGCCGGCGAAGAAGAGGAAGCAGGCTCGAGTTGATTACGACGACGATGGCGAGA
ACTCTAACCCCACCTATCGTTGTCTTCCGGCTAAGAAAAGGATTTGGGCGATTGATCCCGATCTCCTCTCCGTCTCCGGT
AACCCCTTTTCGCCTTTTGATCTGAATGTTGAGTATAAGCCTTCTGTTGAGGAGAAGTCAGTAGCGAAAAAGTCAACTCT
AATGGTTGAATCGAGTCTAGAACTAGAAGATGATGATAAGGAGAACATAGATCCTCTAGGTAATGGGAAAGTTTTGGATC
TAGAAGATAGAAAAGTAGAAGATGAAGATGGGACTATGTGTGCTGTATGTCAAAGTACAGATGGTGAACCATCAAATCCA
ATTGTGTTCTGTGATGGTTGTGATTTGATGGTTCATGCTTCTTGTTATGGGAATCCTCTAGTTAAGGCTATACCAGAAGG
TGATTGGTTTTGTAGTCAGTGTATCTCATCCAACAATCGAGAGAAGCTTCTCTCTTGCTGCTTGTGCACAACTAAAGGCG
GAGCGATGAAACCCACAAATGATGGTAGATGGGCTCACATCACTTGCGCTTTGTTTGTGCCGGAAGTTTACTTTGAGGAT
CCTGAAGGAAGGGAAGGGATCTGTTGTAGTGAGGTGCCGAGTAAGAGATGGAAAGATAGGTGTTATTTGTGTAAGAGTAG
ACGCGGTTGTGTTATCAAGTGCTCGGAGATGAGATGTCAGTTGGATTTTCATGTTACTTGTGGGTTGAAGGAAGATCTTT
GTATTGAGTATCGTGAAGACAAGAAGACTGGTGGTATCGTTGTTGGTTTCTGCAATGACCATACCAAATTGTGGGAAAGG
GAAAGTGGGAAGTACAAGATTGTTGCCAGAGATGAAGATAAAAAGTAG