Details for Capsella Locus Carubv10015309m

Position : scaf_3 ( 5`- 1780801 .. 1782729 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015309m

Protein [Map View]
LRHTLLMINDCKEKLINQWNTSVDSFSISFRLVALPESDPRRCHNKSSFPVKKFTLLISSFGYNIDLQDLVGESFIILKL
NVFPVNRWHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHTFHLHCILKWVNSQTSQAHCPMCRREW
QFKE*

DNA
TTACGTCATACGTTACTGATGATCAATGATTGTAAGGAAAAACTCATTAACCAGTGGAACACGTCCGTCGACTCGTTTTC
AATTTCGTTTCGTCTTGTTGCTCTTCCCGAGTCCGATCCTCGCCGGTGCCACAACAAATCTTCTTTCCCGGTGAAGAAGT
TTACTCTTTTGATTTCCTCGTTCGGTTATAATATCGATCTTCAGGATTTGGTGGGAGAAAGTTTCATAATTTTGAAGCTA
AATGTTTTTCCTGTGAATAGATGGCATGCAGTTGCTTCATGGACATGGGATGCACAAGACGAAACATGTGGGATATGTCG
GATGGCTTTTGATGGTTGTTGTCCTGATTGCAAACTTCCTGGAGATGATTGCCCTCTAATTTGGGGAGCTTGCAACCACA
CGTTTCATCTTCACTGTATATTGAAGTGGGTGAATTCACAGACGAGCCAAGCTCATTGCCCAATGTGCCGAAGAGAATGG
CAGTTCAAAGAGTGA