Details for Capsella Locus Carubv10015295m

Position : scaf_3 ( 5`- 4073549 .. 4073815 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015295m

Protein [Map View]
MKKIVPLMLIALVILLSAPIKIAGDKVMAQCIDEIGYCLSAIHKNTKLPGYCCGKLVKPQPCACKYFTQNPVLLPKVLRA
CRVPHPKC*

DNA
ATGAAGAAGATCGTTCCTTTGATGCTCATTGCCTTGGTCATACTGTTATCAGCTCCCATCAAAATTGCTGGTGATAAAGT
GATGGCCCAATGCATTGATGAGATTGGCTATTGCTTAAGTGCCATTCATAAAAATACCAAATTGCCGGGTTACTGTTGTG
GGAAACTTGTAAAGCCACAACCATGTGCATGTAAGTATTTTACTCAGAACCCTGTGCTACTCCCCAAAGTTCTCAGAGCT
TGCCGTGTTCCTCATCCTAAGTGTTAA