Details for Capsella Locus Carubv10015290m

Position : scaf_3 ( 5`- 7090996 .. 7092172 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015290m

Protein [Map View]
MTCMRDLSQDLVVEILSRLPKTCLGAVRCTCKEWNALSRDRILCTVQANQQFLGFMIVEHRLCSMRFDLHGILNEDGEDL
DMSTLVVWNPYLGQTRWIKTTKTTQRKTMFVLGYDKNKNHKILSFYEDNQGYCDIYDFKTDSWRSLTFIPNNWNIICHWQ
GPRGFSVNGNTYFCTQERKEDEDSDYDDGTADCLICFDFTEERFGKFLDLPFRLDVSDFVSCVKEEKLAAVYLDYGDIDT
SGIIEIWVTSKIEPNAVSWIPFFKVDIEPLAGPELFDFDGDYDSFFIDEEKKLAVVFTSDGDTYAEPLYKKAYIIGEDSY
FKKVDIGEVKAYSSFVCSSSYVPSLVQINQTAVPKSREIKKKKRKRN*

DNA
ATGACGTGCATGAGAGATCTTTCGCAGGATTTGGTAGTGGAGATCTTGTCTAGGCTTCCGAAAACTTGTCTTGGAGCAGT
GAGATGTACTTGCAAAGAATGGAACGCTTTATCCAGAGATCGTATTCTATGTACAGTACAAGCAAACCAGCAGTTTCTGG
GGTTCATGATCGTGGAGCATAGGCTTTGTTCAATGAGGTTCGATCTCCATGGAATCCTCAACGAAGATGGTGAAGACTTG
GATATGTCAACGCTCGTGGTTTGGAACCCATATTTAGGACAAACCAGATGGATCAAGACCACTAAAACCACACAAAGAAA
AACAATGTTTGTTCTTGGATATGACAAAAACAAAAACCACAAAATATTGAGTTTTTATGAAGATAACCAGGGCTACTGCG
ATATTTACGATTTTAAGACTGATTCATGGAGGAGTTTAACTTTTATTCCCAACAACTGGAATATAATCTGTCACTGGCAG
GGACCGAGGGGTTTTTCTGTAAATGGAAATACTTATTTCTGCACACAAGAAAGAAAAGAAGATGAAGATTCAGACTACGA
TGATGGAACCGCTGATTGCTTAATCTGTTTTGATTTTACAGAAGAGAGATTTGGAAAGTTTCTTGATCTACCGTTTCGGC
TTGATGTTTCTGATTTTGTATCTTGTGTTAAAGAAGAGAAACTCGCTGCGGTATACCTAGACTATGGTGATATTGATACA
AGTGGAATAATAGAGATATGGGTTACTAGTAAGATAGAGCCCAATGCAGTGTCGTGGATCCCCTTCTTCAAAGTTGATAT
TGAGCCACTCGCTGGTCCTGAACTATTCGATTTTGATGGAGATTACGACAGTTTCTTCATTGACGAAGAGAAGAAACTCG
CTGTGGTTTTTACTTCAGACGGCGACACCTACGCAGAGCCACTCTACAAAAAAGCTTACATCATCGGAGAAGATAGTTAC
TTTAAAAAAGTGGATATTGGAGAAGTTAAAGCATATAGTAGCTTTGTGTGTTCAAGCTCTTATGTTCCAAGTTTAGTGCA
AATCAACCAAACTGCGGTACCCAAAAGCAGAGAGATCAAGAAGAAGAAGAGGAAGAGGAATTGA