Details for Capsella Locus Carubv10015288m

Position : scaf_3 ( 5`- 1259856 .. 1260909 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015288m

Protein [Map View]
MAMEVATPAPAPIPAERNIVLSPATTTVNVETHKKNRIQVSNTKKPLFFYVNLAKRYIQQHNEVELSALGMAITTVVTIS
EILKNNGLATEKKVLTSTVGMKDETKGRMVQKAKIEIVLGKSDKFDSLVPPVTNGKTPEEEANAETEAAVEAQEVAATEA
*

DNA
ATGGCGATGGAAGTAGCAACTCCGGCTCCGGCACCTATCCCAGCGGAGAGGAACATCGTTCTTTCCCCGGCCACGACTAC
CGTCAATGTTGAGACTCACAAGAAGAACAGGATCCAAGTCTCCAACACCAAGAAGCCTCTATTCTTCTACGTCAACCTCG
CCAAGAGGTACATTCAGCAACACAACGAGGTTGAGCTCTCTGCACTTGGAATGGCAATCACGACTGTGGTTACAATCTCT
GAGATCTTGAAGAACAATGGTCTTGCAACAGAGAAAAAGGTGCTAACATCTACTGTGGGAATGAAAGATGAGACTAAAGG
AAGAATGGTTCAGAAGGCAAAGATTGAGATTGTGTTGGGAAAATCAGACAAGTTCGACTCTTTGGTGCCACCAGTGACCA
ACGGCAAGACTCCGGAGGAGGAAGCTAATGCAGAGACGGAGGCTGCCGTGGAAGCACAAGAAGTTGCTGCCACTGAAGCC
TAA