Details for Capsella Locus Carubv10015281m

Position : scaf_3 ( 5`- 8194172 .. 8195143 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015281m

Protein [Map View]
MALMVLRRNCLRLLDSTSVLRPASHCFSTRFSNSETGKKDSVGENAVGLTGCGIETVDDEAWHVSSSLSQAWRQFQADTA
KHSPLTLQVGKETMLNDEEDPDLDHDEIDNMRIRGDLFFKLDRGSKEFEEYNYDFHRKNQHKNARKEQNQEEGTKMKKNN
KKEVREEYKKRDEPMINFFTGEMVHPNAAEKKRERTFTFNQLTAPFHYPFCLDIYISKASVRACVIHRVTSKVVTVAHSI
SKDMKFDLGSTRNAEACAAVGAVLAQRSLEDDIHDVVYTPRKGDKIEGKLQVVLQALIDNGVNVKVKLKQRKLKKKTNHL
TMA*

DNA
ATGGCTTTGATGGTTTTGAGAAGAAACTGTCTCCGTTTGCTGGATTCCACCTCCGTTTTACGACCAGCATCTCATTGTTT
CTCAACGAGATTCTCCAATAGTGAAACTGGAAAAAAGGATTCAGTAGGTGAAAACGCTGTTGGTTTGACTGGTTGTGGTA
TAGAAACTGTGGATGATGAAGCTTGGCATGTCTCGTCATCTTTATCCCAAGCCTGGCGACAATTCCAAGCAGACACTGCA
AAACACTCACCCTTAACATTACAAGTAGGAAAAGAAACAATGCTCAATGATGAAGAAGATCCGGATCTTGATCATGATGA
AATCGATAATATGAGAATTCGCGGTGATCTTTTCTTCAAGCTTGATCGAGGTTCAAAAGAATTCGAGGAATACAACTACG
ACTTCCACCGCAAGAATCAACACAAGAACGCTCGCAAAGAGCAAAACCAAGAAGAAGGAACAAAGATGAAGAAGAATAAT
AAGAAGGAAGTTCGTGAGGAATACAAGAAGAGAGATGAGCCGATGATTAACTTTTTTACCGGTGAAATGGTTCATCCTAA
TGCAGCTGAGAAGAAGAGAGAAAGAACATTTACATTTAACCAACTCACGGCTCCTTTCCATTACCCGTTTTGCTTGGACA
TCTACATCTCAAAGGCCTCGGTTCGAGCATGCGTGATTCACAGGGTGACTAGTAAGGTTGTCACAGTGGCTCATTCCATT
TCAAAAGACATGAAATTCGATCTTGGTTCGACTAGAAACGCTGAAGCTTGCGCCGCAGTTGGGGCAGTCCTTGCTCAAAG
AAGCTTGGAAGATGACATACACGACGTTGTATACACTCCTAGGAAAGGAGATAAAATTGAAGGTAAGCTTCAGGTCGTGC
TTCAAGCTCTCATTGACAATGGTGTTAATGTTAAAGTGAAGCTTAAGCAGAGGAAACTCAAGAAGAAGACTAATCATCTA
ACGATGGCCTAG