Details for Capsella Locus Carubv10015278m

Position : scaf_3 ( 5`- 2072469 .. 2075081 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015278m

Protein [Map View]
MSEKLEDEPSISLRQLMANEGIIPSLEDREKRRVVIDRLRMIVVRWVKTVAWKRRLPQHQIDATNATIIAYGSYGLGVYG
SESDIDALLIGPFFASMAEDFFIGLRDMLITRREVSEVHCVKDAKVPLIRFKFDGILVDLPYAQLRVLSVPHNVDVLNPF
FLRDIDETSWKSLSGVRANKFILQLVPSLELFQSLLRCVKLWAKRRGVYGNLNGFLGGVHMAVLAAFVCGYERNATLSSL
LANFFNTFAHWQWPIPVMLLDDTYPATGSPPGLMPIQLPCGPHQFCNSNITRSTFYKIMAEFLRGHNVTKDYLNPNFSWK
NLFEPYPYANTYTWFTKIHLSAANQEDLSNWVGWVKSRFRCLLLKIEEVYGFCDPNPTEYVETYAKQPNIVFYWGLQLRT
INVSDIESVETNFLKNLNSGSFQGPVGRIHLSVVKASQLPRNSDCASDNRSKKVTRTCWRIRIREDKQQCKNVPVYSKHL
PGYVVGYEKIHHREDEGTEV*

DNA
ATGTCTGAAAAGTTAGAAGATGAACCCTCGATTTCGCTTCGTCAGCTTATGGCTAACGAAGGAATCATTCCGTCTCTTGA
AGACCGGGAGAAACGAAGAGTTGTTATTGATAGGCTACGAATGATAGTGGTAAGATGGGTTAAGACTGTTGCCTGGAAAC
GCCGTCTTCCTCAACATCAGATTGACGCCACCAACGCCACCATTATTGCTTATGGTTCTTATGGTCTTGGGGTTTATGGT
TCTGAATCAGACATTGACGCTCTGTTGATTGGTCCTTTCTTTGCGTCTATGGCTGAGGATTTTTTCATCGGCTTGCGTGA
TATGTTGATAACTAGACGAGAAGTTTCTGAGGTTCATTGTGTTAAAGATGCGAAAGTTCCTCTGATCCGCTTTAAGTTTG
ATGGGATCTTGGTTGATCTTCCATATGCTCAGCTTAGAGTATTATCCGTTCCACACAATGTAGATGTGCTTAATCCTTTC
TTTCTGAGGGATATTGATGAGACAAGTTGGAAAAGCTTGTCTGGAGTTCGTGCTAATAAATTCATTCTTCAATTAGTGCC
TTCCTTGGAGCTATTCCAATCATTGCTGCGGTGTGTCAAATTATGGGCAAAGAGGCGAGGTGTATACGGTAACTTGAATG
GCTTCCTAGGGGGAGTTCATATGGCTGTTCTTGCTGCATTTGTCTGTGGATATGAACGGAATGCTACACTGAGTTCCCTT
CTGGCAAATTTCTTCAACACATTTGCTCATTGGCAATGGCCTATACCGGTGATGCTGCTAGATGATACTTATCCAGCTAC
TGGCTCTCCACCAGGGTTAATGCCCATCCAATTGCCGTGCGGTCCACATCAATTCTGCAACTCTAACATAACAAGAAGCA
CATTTTACAAAATTATGGCAGAGTTTCTACGAGGGCATAATGTGACAAAGGATTACTTGAACCCTAACTTCAGTTGGAAG
AATTTGTTTGAGCCATATCCATATGCAAACACATACACGTGGTTCACCAAGATACACCTCTCGGCTGCTAATCAGGAAGA
TCTCAGTAATTGGGTTGGTTGGGTTAAGTCACGTTTCCGTTGTCTTCTGCTCAAGATAGAGGAAGTCTATGGCTTTTGCG
ACCCAAACCCAACAGAGTATGTCGAAACCTATGCAAAGCAGCCAAACATTGTGTTTTACTGGGGACTACAGCTCAGAACA
ATAAATGTTTCAGACATTGAATCTGTGGAGACAAACTTTCTGAAGAACCTTAACAGTGGAAGCTTCCAGGGACCAGTTGG
TAGAATCCATTTATCGGTTGTGAAAGCGTCCCAGCTGCCTAGGAATAGTGATTGTGCTAGCGACAACAGAAGCAAGAAGG
TGACAAGGACTTGTTGGAGAATCAGAATCCGGGAAGATAAGCAACAATGCAAGAATGTACCGGTTTACTCAAAGCATTTG
CCTGGTTATGTGGTTGGGTATGAGAAGATACATCACAGAGAGGATGAGGGCACGGAGGTTTAG