Details for Capsella Locus Carubv10015270m

Position : scaf_3 ( 5`- 8100784 .. 8102900 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10015270m

Protein [Map View]
MKVTKKRKIIFIPYPAQGHVTPMLHLASAFLSRGFSPVVMTPESIHRRISTTNEDLGITFLPLYDGQDRPDAPPSDFFSI
ENSMENLMPSQLERLLLDKDLGVACVVVDLLASWAIRVADQCGVPVAGFWPVMFAAYRLIQTIPELVRTGIVSRKGCPRQ
PEKPLVLPEQPVLLSAEDLPWLIGTPKAQKRRFKFWQRTLERTKGLRWILVNSFKDEYDGFNYQKTPYKLFKDFHKENNC
QTPQILQVGPLHYYQAETSNIAITKTSLWEADISCIGWLQEQNPNSVIYISFGSWVSPIGESNIRMLALALEASGRPFLW
ALNRVWQEGLPPGFVHRVTIAKNQGRIVSWAPQLEVLRNDSVGCYVTHCGWNSTMEAVASSRRLLCYPVAGDQFVNCKYI
VDVWKIGMRMSGFGEKEVEDGLRKVMEDQDMGERLKKLKDKAMGNEARLSSERNFILFKDEIK*

DNA
ATGAAAGTAACAAAAAAGCGTAAGATAATATTCATCCCTTACCCGGCGCAAGGCCACGTCACTCCGATGCTCCACCTCGC
ATCAGCCTTCCTCAGCCGTGGATTCTCCCCTGTCGTTATGACTCCCGAGTCTATCCACCGTCGGATCTCAACTACTAACG
AGGATCTTGGGATCACGTTCTTGCCCTTATATGACGGTCAAGATCGTCCGGACGCACCTCCTTCGGACTTCTTTTCGATA
GAGAACTCGATGGAGAACCTCATGCCTTCTCAGCTCGAACGGCTCCTACTAGATAAAGATTTAGGTGTGGCTTGTGTTGT
GGTTGATCTGTTGGCTTCGTGGGCTATAAGAGTGGCTGATCAGTGTGGAGTTCCCGTCGCCGGATTCTGGCCGGTGATGT
TTGCTGCTTACCGTTTGATCCAAACCATACCGGAGCTAGTACGGACAGGCATAGTTTCCCGAAAAGGTTGTCCTCGTCAA
CCAGAGAAGCCACTAGTCCTGCCGGAGCAACCAGTACTTCTATCTGCAGAAGATCTACCATGGCTCATCGGAACTCCCAA
AGCTCAAAAAAGACGATTCAAATTCTGGCAAAGAACACTAGAAAGAACAAAAGGTCTTCGCTGGATCTTGGTAAACTCAT
TCAAAGACGAATATGATGGTTTCAACTATCAAAAAACACCTTACAAGTTGTTTAAAGATTTCCACAAAGAAAACAATTGT
CAAACTCCTCAAATTTTACAAGTCGGTCCTTTGCATTATTACCAAGCAGAAACAAGTAATATAGCTATAACGAAGACTAG
TTTATGGGAAGCGGACATATCTTGTATTGGTTGGCTTCAAGAACAAAACCCGAACTCAGTCATTTATATCTCATTTGGGA
GTTGGGTTTCTCCGATAGGAGAATCAAATATTAGAATGTTGGCATTGGCACTGGAAGCGTCAGGTAGACCATTCCTTTGG
GCGCTAAACCGAGTGTGGCAAGAAGGTCTTCCACCAGGGTTTGTGCATAGAGTCACCATTGCCAAGAACCAAGGAAGGAT
CGTCTCTTGGGCTCCGCAGCTTGAAGTTCTTAGAAACGACTCTGTGGGGTGTTACGTGACTCATTGTGGCTGGAACTCGA
CCATGGAGGCGGTGGCAAGTTCTCGGAGGCTACTATGTTATCCGGTGGCCGGAGACCAGTTTGTAAACTGTAAATACATC
GTGGACGTGTGGAAGATTGGGATGAGGATGAGCGGGTTTGGTGAGAAAGAGGTTGAAGATGGGCTAAGGAAAGTAATGGA
GGATCAAGACATGGGTGAGAGATTGAAGAAGTTGAAAGACAAAGCAATGGGGAATGAAGCTCGTTTGTCTTCGGAAAGGA
ACTTCATTCTTTTTAAAGATGAGATCAAATAG